Recombinant Human CDKN1C Protein, GST-Tagged
Cat.No. : | CDKN1C-1059H |
Product Overview : | Human CDKN1C partial ORF (NP_000067, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKN1C cyclin-dependent kinase inhibitor 1C (p57, Kip2) [ Homo sapiens ] |
Official Symbol | CDKN1C |
Synonyms | CDKN1C; cyclin-dependent kinase inhibitor 1C (p57, Kip2); Beckwith Wiedemann syndrome, BWCR, BWS; cyclin-dependent kinase inhibitor 1C; KIP2; P57; p57Kip2; cyclin-dependent kinase inhibitor p57; BWS; WBS; p57; BWCR; |
Gene ID | 1028 |
mRNA Refseq | NM_000076 |
Protein Refseq | NP_000067 |
MIM | 600856 |
UniProt ID | P49918 |
◆ Recombinant Proteins | ||
CDKN1C-3222M | Recombinant Mouse CDKN1C Protein | +Inquiry |
CDKN1C-1536M | Recombinant Mouse CDKN1C Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKN1C-11061H | Recombinant Human CDKN1C, His-tagged | +Inquiry |
CDKN1C-30575TH | Recombinant Human CDKN1C | +Inquiry |
CDKN1C-275Z | Recombinant Zebrafish CDKN1C | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN1C Products
Required fields are marked with *
My Review for All CDKN1C Products
Required fields are marked with *
0
Inquiry Basket