Recombinant Human CDKN2C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CDKN2C-4708H
Product Overview : CDKN2C MS Standard C13 and N15-labeled recombinant protein (NP_001253) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.
Molecular Mass : 17.9 kDa
AA Sequence : MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CDKN2C cyclin dependent kinase inhibitor 2C [ Homo sapiens (human) ]
Official Symbol CDKN2C
Synonyms CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18; p18-INK4C;
Gene ID 1031
mRNA Refseq NM_001262
Protein Refseq NP_001253
MIM 603369
UniProt ID P42773

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKN2C Products

Required fields are marked with *

My Review for All CDKN2C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon