Recombinant Human CDKN2C protein, T7-tagged

Cat.No. : CDKN2C-117H
Product Overview : Recombinant human CDKN2C fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQENGRGEFAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGA NPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHK GDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for studying cell cycle regulation and tumorigenesis in vitro.2. As active protein, may be used for studying pRB/p18 interaction pathway in vitro.3. As immunogen for specific antibody production.4. As potential biomarker protein for cancer diagnosis in vitro.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ]
Official Symbol CDKN2C
Synonyms CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18; p18-INK4C;
Gene ID 1031
mRNA Refseq NM_001262
Protein Refseq NP_001253
MIM 603369
UniProt ID P42773
Chromosome Location 1p32.3
Pathway Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Cyclin D associated events in G1, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; G1 Phase, organism-specific biosystem;
Function cyclin-dependent protein kinase inhibitor activity; protein kinase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKN2C Products

Required fields are marked with *

My Review for All CDKN2C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon