Recombinant Human CDKN2C protein, T7-tagged

• Cat.No.: CDKN2C-117H
• Product Overview: Recombinant human CDKN2C fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQENGRGEFAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGA NPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHK GDTACDLARLYGRNEVVSLMQANGAGGATNLQ
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for studying cell cycle regulation and tumorigenesis in vitro.2. As active protein, may be used for studying pRB/p18 interaction pathway in vitro.3. As immunogen for specific antibody production.4. As potential biomarker protein for cancer diagnosis in vitro.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ]
• Official Symbol: CDKN2C
• Synonyms: CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18; p18-INK4C
• Gene ID: 1031
• mRNA Refseq: NM_001262
• Protein Refseq: NP_001253
• MIM: 603369
• UniProt ID: P42773
• Chromosome Location: 1p32.3
• Pathway: Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Cyclin D associated events in G1, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; G1 Phase, organism-specific biosystem
• Function: cyclin-dependent protein kinase inhibitor activity; protein kinase binding