Recombinant Human CDKN2C protein, T7-tagged
Cat.No. : | CDKN2C-117H |
Product Overview : | Recombinant human CDKN2C fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQENGRGEFAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGA NPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHK GDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for studying cell cycle regulation and tumorigenesis in vitro.2. As active protein, may be used for studying pRB/p18 interaction pathway in vitro.3. As immunogen for specific antibody production.4. As potential biomarker protein for cancer diagnosis in vitro. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ] |
Official Symbol | CDKN2C |
Synonyms | CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18; p18-INK4C; |
Gene ID | 1031 |
mRNA Refseq | NM_001262 |
Protein Refseq | NP_001253 |
MIM | 603369 |
UniProt ID | P42773 |
Chromosome Location | 1p32.3 |
Pathway | Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Cyclin D associated events in G1, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; G1 Phase, organism-specific biosystem; |
Function | cyclin-dependent protein kinase inhibitor activity; protein kinase binding; |
◆ Recombinant Proteins | ||
CDKN2C-1377H | Recombinant Human Cyclin-Dependent Kinase Inhibitor 2C (p18, inhibits CDK4), His-tagged | +Inquiry |
CDKN2C-1294H | Recombinant Human CDKN2C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDKN2C-30052TH | Recombinant Human CDKN2C | +Inquiry |
CDKN2C-3230HF | Recombinant Full Length Human CDKN2C Protein, GST-tagged | +Inquiry |
CDKN2C-117H | Recombinant Human CDKN2C protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN2C-7612HCL | Recombinant Human CDKN2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2C Products
Required fields are marked with *
My Review for All CDKN2C Products
Required fields are marked with *