"CDKN2C" Related Products

Expand
Expand

Recombinant Human CDKN2C protein, T7-tagged

Cat.No.: CDKN2C-117H
Product Overview: Recombinant human CDKN2C fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQENGRGEFAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGA NPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHK GDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for studying cell cycle regulation and tumorigenesis in vitro.2. As active protein, may be used for studying pRB/p18 interaction pathway in vitro.3. As immunogen for specific antibody production.4. As potential biomarker protein for cancer diagnosis in vitro.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ]
Official Symbol: CDKN2C
Synonyms: CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18; p18-INK4C;
Gene ID: 1031
mRNA Refseq: NM_001262
Protein Refseq: NP_001253
MIM: 603369
UniProt ID: P42773
Chromosome Location: 1p32.3
Pathway: Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Cyclin D associated events in G1, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; G1 Phase, organism-specific biosystem;
Function: cyclin-dependent protein kinase inhibitor activity; protein kinase binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.