Recombinant Human CDKN3 Protein (1-212 aa), His-tagged
Cat.No. : | CDKN3-2236H |
Product Overview : | Recombinant Human CDKN3 Protein (1-212 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-212 aa |
Description : | May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CDKN3 cyclin-dependent kinase inhibitor 3 [ Homo sapiens ] |
Official Symbol | CDKN3 |
Synonyms | CDKN3; CDI1; KAP; CIP2; KAP1; FLJ25787; MGC70625; |
Gene ID | 1033 |
mRNA Refseq | NM_001130851 |
Protein Refseq | NP_001124323 |
MIM | 123832 |
UniProt ID | Q16667 |
◆ Recombinant Proteins | ||
CDKN3-26472TH | Recombinant Human CDKN3 | +Inquiry |
CDKN3-1067H | Recombinant Human CDKN3 Protein, GST-Tagged | +Inquiry |
CDKN3-26470TH | Recombinant Human CDKN3, His-tagged | +Inquiry |
CDKN3-7370Z | Recombinant Zebrafish CDKN3 | +Inquiry |
CDKN3-624R | Recombinant Rhesus Macaque CDKN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN3-7609HCL | Recombinant Human CDKN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN3 Products
Required fields are marked with *
My Review for All CDKN3 Products
Required fields are marked with *