Recombinant Human CDPF1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDPF1-6525H |
Product Overview : | C22orf40 MS Standard C13 and N15-labeled recombinant protein (NP_997210) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CDPF1 (Cysteine Rich DPF Motif Domain Containing 1) is a Protein Coding gene. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | MASHVECRPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPECSLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPSKRTPSQPGSRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDPF1 cysteine rich DPF motif domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | CDPF1 |
Synonyms | CDPF1; cysteine rich DPF motif domain containing 1; C22orf40; cysteine-rich DPF motif domain-containing protein 1; UPF0595 protein C22orf40 |
Gene ID | 150383 |
mRNA Refseq | NM_207327 |
Protein Refseq | NP_997210 |
UniProt ID | Q6NVV7 |
◆ Recombinant Proteins | ||
Cdpf1-2095M | Recombinant Mouse Cdpf1 Protein, Myc/DDK-tagged | +Inquiry |
CDPF1-6525H | Recombinant Human CDPF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDPF1-8088HCL | Recombinant Human C22orf40 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDPF1 Products
Required fields are marked with *
My Review for All CDPF1 Products
Required fields are marked with *