Recombinant Human CDRT15 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CDRT15-2437H |
| Product Overview : | CDRT15 MS Standard C13 and N15-labeled recombinant protein (NP_001007531) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | CDRT15 (CMT1A Duplicated Region Transcript 15) is a Protein Coding gene. Diseases associated with CDRT15 include Charcot-Marie-Tooth Disease. An important paralog of this gene is CDRT15L2. |
| Molecular Mass : | 20.5 kDa |
| AA Sequence : | MFSCCFPTSRGCCFRNGGSESLFRRCRRRLIPHPRRLSPVVIRRIQVPQDSLGQALAGQATPEIPLGLQLHTVLVQEIQELIEAQTLAPGPCAEVRALPAPAAEPEPAWEEAPPERALELEGAPAKDQTNEELPEITEVPESIKRRLGRRVPAATPAPRGNLLLQAWMRVHSWASRLFAPNVLPGTGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CDRT15 CMT1A duplicated region transcript 15 [ Homo sapiens (human) ] |
| Official Symbol | CDRT15 |
| Synonyms | CDRT15; CMT1A duplicated region transcript 15; CMT1A duplicated region transcript 15 protein |
| Gene ID | 146822 |
| mRNA Refseq | NM_001007530 |
| Protein Refseq | NP_001007531 |
| UniProt ID | Q96T59 |
| ◆ Recombinant Proteins | ||
| CDRT15-2437H | Recombinant Human CDRT15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CDRT15-3168H | Recombinant Human CDRT15 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDRT15 Products
Required fields are marked with *
My Review for All CDRT15 Products
Required fields are marked with *



