Recombinant Human CDRT15 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CDRT15-2437H
Product Overview : CDRT15 MS Standard C13 and N15-labeled recombinant protein (NP_001007531) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CDRT15 (CMT1A Duplicated Region Transcript 15) is a Protein Coding gene. Diseases associated with CDRT15 include Charcot-Marie-Tooth Disease. An important paralog of this gene is CDRT15L2.
Molecular Mass : 20.5 kDa
AA Sequence : MFSCCFPTSRGCCFRNGGSESLFRRCRRRLIPHPRRLSPVVIRRIQVPQDSLGQALAGQATPEIPLGLQLHTVLVQEIQELIEAQTLAPGPCAEVRALPAPAAEPEPAWEEAPPERALELEGAPAKDQTNEELPEITEVPESIKRRLGRRVPAATPAPRGNLLLQAWMRVHSWASRLFAPNVLPGTGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CDRT15 CMT1A duplicated region transcript 15 [ Homo sapiens (human) ]
Official Symbol CDRT15
Synonyms CDRT15; CMT1A duplicated region transcript 15; CMT1A duplicated region transcript 15 protein
Gene ID 146822
mRNA Refseq NM_001007530
Protein Refseq NP_001007531
UniProt ID Q96T59

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDRT15 Products

Required fields are marked with *

My Review for All CDRT15 Products

Required fields are marked with *

0
cart-icon