Recombinant Human CDS2 protein, His-tagged
| Cat.No. : | CDS2-3617H |
| Product Overview : | Recombinant Human CDS2 protein(1-65 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-65 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CDS2 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [ Homo sapiens ] |
| Official Symbol | CDS2 |
| Synonyms | CDS2; CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2; phosphatidate cytidylyltransferase 2; CDS 2; CDP-DG synthase 2; CDP-DAG synthase 2; CDP-DG synthetase 2; CDP-diglyceride synthase 2; CDP-diglyceride synthetase 2; CDP-diacylglycerol synthase 2; CDP-diglyceride diphosphorylase 2; CDP-diglyceride pyrophosphorylase 2; CTP:phosphatidate cytidylyltransferase 2; FLJ12936; FLJ38111; FLJ41837; |
| Gene ID | 8760 |
| mRNA Refseq | NM_003818 |
| Protein Refseq | NP_003809 |
| MIM | 603549 |
| UniProt ID | O95674 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDS2 Products
Required fields are marked with *
My Review for All CDS2 Products
Required fields are marked with *
