Recombinant Human CDV3 Protein, GST-tagged

• Cat.No.: CDV3-5174H
• Product Overview: Human CDV3 full-length ORF ( AAH07338.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CDV3 (CDV3 Homolog) is a Protein Coding gene.
• Molecular Mass: 48.5 kDa
• AA Sequence: MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRNRYLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDV3 CDV3 homolog [ Homo sapiens (human) ]
• Official Symbol: CDV3
• Synonyms: CDV3; CDV3 homolog; H41; protein CDV3 homolog; carnitine deficiency-associated gene expressed in ventricle 3
• Gene ID: 55573
• mRNA Refseq: NM_001134422
• Protein Refseq: NP_001127894
• UniProt ID: Q9UKY7