Recombinant Full Length Human CDV3 Protein, GST-tagged
Cat.No. : | CDV3-3828HF |
Product Overview : | Human CDV3 full-length ORF ( AAH07338.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 213 amino acids |
Description : | CDV3 (CDV3 Homolog) is a Protein Coding gene. |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRNRYLK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDV3 CDV3 homolog [ Homo sapiens (human) ] |
Official Symbol | CDV3 |
Synonyms | CDV3; CDV3 homolog; H41; protein CDV3 homolog; carnitine deficiency-associated gene expressed in ventricle 3 |
Gene ID | 55573 |
mRNA Refseq | NM_001134422 |
Protein Refseq | NP_001127894 |
MIM | 618789 |
UniProt ID | Q9UKY7 |
◆ Recombinant Proteins | ||
CDV3-5174H | Recombinant Human CDV3 Protein, GST-tagged | +Inquiry |
CDV3-3828HF | Recombinant Full Length Human CDV3 Protein, GST-tagged | +Inquiry |
CDV3-1321R | Recombinant Rat CDV3 Protein | +Inquiry |
CDV3-11993Z | Recombinant Zebrafish CDV3 | +Inquiry |
CDV3-2674C | Recombinant Chicken CDV3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDV3-330HCL | Recombinant Human CDV3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDV3 Products
Required fields are marked with *
My Review for All CDV3 Products
Required fields are marked with *
0
Inquiry Basket