Recombinant Human CDX4 Protein, GST-Tagged

• Cat.No.: CDX4-1084H
• Product Overview: Human CDX4 partial ORF (NP_005184.1, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of a small subfamily of homeobox containing transcription factors. The encoded protein may regulate homeobox gene expression during anteroposterior patterning and hematopoiesis. [provided by RefSeq, Aug 2012]
• Molecular Mass: 36.74 kDa
• AA Sequence: VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDX4 caudal type homeobox 4 [ Homo sapiens ]
• Official Symbol: CDX4
• Synonyms: CDX4; caudal type homeobox 4; caudal type homeo box transcription factor 4; homeobox protein CDX-4; caudal-type homeobox protein 4; caudal type homeobox transcription factor 4
• Gene ID: 1046
• mRNA Refseq: NM_005193
• Protein Refseq: NP_005184
• MIM: 300025
• UniProt ID: O14627