Recombinant Human CDX4 Protein, GST-Tagged

Cat.No. : CDX4-1084H
Product Overview : Human CDX4 partial ORF (NP_005184.1, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of a small subfamily of homeobox containing transcription factors. The encoded protein may regulate homeobox gene expression during anteroposterior patterning and hematopoiesis. [provided by RefSeq, Aug 2012]
Molecular Mass : 36.74 kDa
AA Sequence : VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDX4 caudal type homeobox 4 [ Homo sapiens ]
Official Symbol CDX4
Synonyms CDX4; caudal type homeobox 4; caudal type homeo box transcription factor 4; homeobox protein CDX-4; caudal-type homeobox protein 4; caudal type homeobox transcription factor 4;
Gene ID 1046
mRNA Refseq NM_005193
Protein Refseq NP_005184
MIM 300025
UniProt ID O14627

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDX4 Products

Required fields are marked with *

My Review for All CDX4 Products

Required fields are marked with *

0
cart-icon
0
compare icon