Recombinant Human CDX4 Protein, GST-Tagged
Cat.No. : | CDX4-1084H |
Product Overview : | Human CDX4 partial ORF (NP_005184.1, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a small subfamily of homeobox containing transcription factors. The encoded protein may regulate homeobox gene expression during anteroposterior patterning and hematopoiesis. [provided by RefSeq, Aug 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDX4 caudal type homeobox 4 [ Homo sapiens ] |
Official Symbol | CDX4 |
Synonyms | CDX4; caudal type homeobox 4; caudal type homeo box transcription factor 4; homeobox protein CDX-4; caudal-type homeobox protein 4; caudal type homeobox transcription factor 4; |
Gene ID | 1046 |
mRNA Refseq | NM_005193 |
Protein Refseq | NP_005184 |
MIM | 300025 |
UniProt ID | O14627 |
◆ Recombinant Proteins | ||
CDX4-1553M | Recombinant Mouse CDX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDX4-8733Z | Recombinant Zebrafish CDX4 | +Inquiry |
CDX4-3243M | Recombinant Mouse CDX4 Protein | +Inquiry |
CDX4-1084H | Recombinant Human CDX4 Protein, GST-Tagged | +Inquiry |
CDX4-6182C | Recombinant Chicken CDX4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDX4-7601HCL | Recombinant Human CDX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDX4 Products
Required fields are marked with *
My Review for All CDX4 Products
Required fields are marked with *
0
Inquiry Basket