Recombinant Human CEACAM7, His-tagged

Cat.No. : CEACAM7-63H
Product Overview : Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7/CEACAM7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr36-Phe142) of Human CEACAM7 fused with a polyhistidine tag at the C-terminus.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 36-142 a.a.
Description : Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy.
AA Sequence : NIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRET IYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ]
Official Symbol CEACAM7
Synonyms CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2;
Gene ID 1087
mRNA Refseq NM_006890
Protein Refseq NP_008821
UniProt ID Q14002
Chromosome Location 19q13.2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM7 Products

Required fields are marked with *

My Review for All CEACAM7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon