Recombinant Human CEACAM7, His-tagged
Cat.No. : | CEACAM7-63H |
Product Overview : | Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7/CEACAM7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr36-Phe142) of Human CEACAM7 fused with a polyhistidine tag at the C-terminus. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 36-142 a.a. |
Description : | Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy. |
AA Sequence : | NIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRET IYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ] |
Official Symbol | CEACAM7 |
Synonyms | CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2; |
Gene ID | 1087 |
mRNA Refseq | NM_006890 |
Protein Refseq | NP_008821 |
UniProt ID | Q14002 |
Chromosome Location | 19q13.2 |
◆ Recombinant Proteins | ||
CEACAM7-1161H | Recombinant Human CEACAM7 Protein, His-SUMO-tagged | +Inquiry |
CEACAM7-3195H | Recombinant Human CEACAM7 Protein, MYC/DDK-tagged | +Inquiry |
CEACAM7-7614H | Recombinant Human CEACAM7, His-tagged | +Inquiry |
CEACAM7-8196H | Recombinant Human CEACAM7 protein, His-tagged | +Inquiry |
CEACAM7-572H | Recombinant Human CEACAM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM7-179HCL | Recombinant Human CEACAM7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM7 Products
Required fields are marked with *
My Review for All CEACAM7 Products
Required fields are marked with *
0
Inquiry Basket