Recombinant Human CEACAM7, His-tagged
| Cat.No. : | CEACAM7-63H |
| Product Overview : | Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7/CEACAM7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr36-Phe142) of Human CEACAM7 fused with a polyhistidine tag at the C-terminus. |
| Availability | August 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 36-142 a.a. |
| Description : | Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy. |
| AA Sequence : | NIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRET IYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ] |
| Official Symbol | CEACAM7 |
| Synonyms | CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2; |
| Gene ID | 1087 |
| mRNA Refseq | NM_006890 |
| Protein Refseq | NP_008821 |
| UniProt ID | Q14002 |
| Chromosome Location | 19q13.2 |
| ◆ Recombinant Proteins | ||
| CEACAM7-8196H | Recombinant Human CEACAM7 protein, His-tagged | +Inquiry |
| CEACAM7-1835HFL | Recombinant Full Length Human CEACAM7 Protein, C-Flag-tagged | +Inquiry |
| CEACAM7-0848H | Recombinant Human CEACAM7 Protein (Lys147-Thr231), His tagged | +Inquiry |
| CEACAM7-3195H | Recombinant Human CEACAM7 Protein, MYC/DDK-tagged | +Inquiry |
| CEACAM7-1161H | Recombinant Human CEACAM7 Protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CEACAM7-179HCL | Recombinant Human CEACAM7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM7 Products
Required fields are marked with *
My Review for All CEACAM7 Products
Required fields are marked with *



