Recombinant Human CEACAM8 Protein, His-tagged
Cat.No. : | CEACAM8-180H |
Product Overview : | Recombinant human CEACAM8 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 349 |
Description : | Enables protein heterodimerization activity. Involved in heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules. Located in cell surface and extracellular space. Biomarker of severe acute respiratory syndrome. |
Form : | Lyophilized |
Molecular Mass : | 33 kDa |
AA Sequence : | MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens (human) ] |
Official Symbol | CEACAM8 |
Synonyms | CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; CD67 antigen; carcinoembryonic antigen CGM6; non-specific cross-reacting antigen NCA-95; carcinoembryonic antigen gene family member 6; CD67; NCA-95; |
Gene ID | 1088 |
mRNA Refseq | NM_001816 |
Protein Refseq | NP_001807 |
MIM | 615747 |
UniProt ID | P31997 |
◆ Recombinant Proteins | ||
CEACAM8-222H | Recombinant Human CEACAM8, C13&N15-labeled | +Inquiry |
CEACAM8-3233H | Recombinant Human CEACAM8 protein, His-tagged | +Inquiry |
CEACAM8-1162H | Recombinant Human CEACAM8 Protein, His-SUMO-tagged | +Inquiry |
CEACAM8-27504TH | Recombinant Human CEACAM8 | +Inquiry |
CEACAM8-0849H | Recombinant Human CEACAM8 Protein (Gln35-Asp320), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM8 Products
Required fields are marked with *
My Review for All CEACAM8 Products
Required fields are marked with *
0
Inquiry Basket