Recombinant Human CEACAM8 Protein, His-tagged

Cat.No. : CEACAM8-180H
Product Overview : Recombinant human CEACAM8 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 349
Description : Enables protein heterodimerization activity. Involved in heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules. Located in cell surface and extracellular space. Biomarker of severe acute respiratory syndrome.
Form : Lyophilized
Molecular Mass : 33 kDa
AA Sequence : MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens (human) ]
Official Symbol CEACAM8
Synonyms CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; CD67 antigen; carcinoembryonic antigen CGM6; non-specific cross-reacting antigen NCA-95; carcinoembryonic antigen gene family member 6; CD67; NCA-95;
Gene ID 1088
mRNA Refseq NM_001816
Protein Refseq NP_001807
MIM 615747
UniProt ID P31997

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM8 Products

Required fields are marked with *

My Review for All CEACAM8 Products

Required fields are marked with *

0
cart-icon
0
compare icon