| Species : | Human | 
                                
                                    | Source : | HEK293 | 
                                
                                    | Tag : | His | 
                                
                                    | Protein Length : | 349 | 
                                
                                    | Description : | Enables protein heterodimerization activity. Involved in heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules. Located in cell surface and extracellular space. Biomarker of severe acute respiratory syndrome. | 
                                
                                    | Form : | Lyophilized | 
                                
                                    | Molecular Mass : | 33 kDa | 
                                
                                    | AA Sequence : | MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI | 
                                
                                    | Purity : | > 98% | 
                                
                                    | Applications : | WB; ELISA; FACS; FC | 
                                
                                    | Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. | 
                                
                                    | Storage : | At -20 centigrade. | 
                                
                                    | Concentration : | 1 mg/mL | 
                                
                                    | Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. | 
                                
                                    | Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |