Recombinant Human CEBPD Protein, GST-Tagged
Cat.No. : | CEBPD-1103H |
Product Overview : | Human CEBPD full-length ORF (NP_005186.2, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 55.99 kDa |
AA Sequence : | MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEBPD CCAAT/enhancer binding protein (C/EBP), delta [ Homo sapiens ] |
Official Symbol | CEBPD |
Synonyms | CEBPD; CCAAT/enhancer binding protein (C/EBP), delta; CCAAT/enhancer-binding protein delta; C/EBP delta; CELF; CRP3; NF IL6 beta; c/EBP delta; nuclear factor NF-IL6-beta; C/EBP-delta; NF-IL6-beta; |
Gene ID | 1052 |
mRNA Refseq | NM_005195 |
Protein Refseq | NP_005186 |
MIM | 116898 |
UniProt ID | P49716 |
◆ Recombinant Proteins | ||
CEBPD-9391Z | Recombinant Zebrafish CEBPD | +Inquiry |
Cebpd-705M | Recombinant Mouse Cebpd Protein, His-tagged | +Inquiry |
CEBPD-1103H | Recombinant Human CEBPD Protein, GST-Tagged | +Inquiry |
CEBPD-1326R | Recombinant Rat CEBPD Protein | +Inquiry |
CEBPD-704H | Recombinant Human CEBPD Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEBPD Products
Required fields are marked with *
My Review for All CEBPD Products
Required fields are marked with *