Recombinant Human CEBPD protein, His&Myc-tagged

Cat.No. : CEBPD-2685H
Product Overview : Recombinant Human CEBPD protein(P49716)(2-269aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 2-269aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.8 kDa
AA Sequence : SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CEBPD CCAAT/enhancer binding protein (C/EBP), delta [ Homo sapiens ]
Official Symbol CEBPD
Synonyms CEBPD; CCAAT/enhancer binding protein (C/EBP), delta; CCAAT/enhancer-binding protein delta; C/EBP delta; CELF; CRP3; NF IL6 beta; c/EBP delta; nuclear factor NF-IL6-beta; C/EBP-delta; NF-IL6-beta;
Gene ID 1052
mRNA Refseq NM_005195
Protein Refseq NP_005186
MIM 116898
UniProt ID P49716

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEBPD Products

Required fields are marked with *

My Review for All CEBPD Products

Required fields are marked with *

0
cart-icon