Recombinant Human CEBPD protein, His&Myc-tagged

• Cat.No.: CEBPD-2685H
• Product Overview: Recombinant Human CEBPD protein(P49716)(2-269aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-269aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.8 kDa
• AA Sequence: SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CEBPD CCAAT/enhancer binding protein (C/EBP), delta [ Homo sapiens ]
• Official Symbol: CEBPD
• Synonyms: CEBPD; CCAAT/enhancer binding protein (C/EBP), delta; CCAAT/enhancer-binding protein delta; C/EBP delta; CELF; CRP3; NF IL6 beta; c/EBP delta; nuclear factor NF-IL6-beta; C/EBP-delta; NF-IL6-beta
• Gene ID: 1052
• mRNA Refseq: NM_005195
• Protein Refseq: NP_005186
• MIM: 116898
• UniProt ID: P49716