Recombinant Human CEBPG, His-tagged
Cat.No. : | CEBPG-95H |
Product Overview : | Recombinant Human CEBP-γ His-Tagged fusion proeint produced inE.Coliis a single,non-glycosylated polypeptide chain containing amino acids 146 and having a molecular mass of 16.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CCAAT/enhancer binding protein(C/EBP) γ is a family of transcription factors all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and/or form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBP γ may cooperate with Fos to bind PRE- enhancer elements. The DNA binding domain of CEBP-γ (amino acid residues, 39-147) was purified by using conventional chromatography techniques |
Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEEN ERLEAKIKLL TKELSVLKDL FLEHAHNLAD NVQSISTENT TADGDN |
Purity : | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by reducing and non-reducing SDS-PAGE Coomassie. |
Physical Appearance : | Sterile filtered clorless solution. |
Formulation : | The protein (1mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol |
Storage : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). |
Gene Name | CEBPG CCAAT/enhancer binding protein (C/EBP), gamma [ Homo sapiens ] |
Synonyms | CEBPG; CCAAT/enhancer binding protein (C/EBP), gamma;GPE1BP; IG/EBP-1; IG/EBP-1; C/EBP gamma; CCAAT/enhancer binding protein gamma |
Gene ID | 1054 |
mRNA Refseq | NM_001806 |
Protein Refseq | NP_001797 |
MIM | 138972 |
UniProt ID | P53567 |
Chromosome Location | 19q13.2 |
Function | double-stranded DNA binding; protein heterodimerization activity; sequence-specific DNA binding; transcription factor activity; transcription factor binding |
◆ Recombinant Proteins | ||
CEBPG-3281HF | Recombinant Full Length Human CEBPG Protein, GST-tagged | +Inquiry |
CEBPG-2234H | Recombinant Human CEBPG protein, His-tagged | +Inquiry |
CEBPG-11087H | Recombinant Human CEBPG, GST-tagged | +Inquiry |
CEBPG-1562M | Recombinant Mouse CEBPG Protein, His (Fc)-Avi-tagged | +Inquiry |
CEBPG-1105H | Recombinant Human CEBPG Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEBPG-7596HCL | Recombinant Human CEBPG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEBPG Products
Required fields are marked with *
My Review for All CEBPG Products
Required fields are marked with *
0
Inquiry Basket