Recombinant Human CEBPG, His-tagged

• Cat.No.: CEBPG-95H
• Product Overview: Recombinant Human CEBP-γ His-Tagged fusion proeint produced inE.Coliis a single,non-glycosylated polypeptide chain containing amino acids 146 and having a molecular mass of 16.5 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: CCAAT/enhancer binding protein(C/EBP) γ is a family of transcription factors all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and/or form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBP γ may cooperate with Fos to bind PRE- enhancer elements. The DNA binding domain of CEBP-γ (amino acid residues, 39-147) was purified by using conventional chromatography techniques
• Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEEN ERLEAKIKLL TKELSVLKDL FLEHAHNLAD NVQSISTENT TADGDN
• Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by reducing and non-reducing SDS-PAGE Coomassie.
• Physical Appearance: Sterile filtered clorless solution.
• Formulation: The protein (1mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol
• Storage: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Gene Information

• Gene Name: CEBPG CCAAT/enhancer binding protein (C/EBP), gamma [ Homo sapiens ]
• Synonyms: CEBPG; CCAAT/enhancer binding protein (C/EBP), gamma;GPE1BP; IG/EBP-1; IG/EBP-1; C/EBP gamma; CCAAT/enhancer binding protein gamma
• Gene ID: 1054
• mRNA Refseq: NM_001806
• Protein Refseq: NP_001797
• MIM: 138972
• UniProt ID: P53567
• Chromosome Location: 19q13.2
• Function: double-stranded DNA binding; protein heterodimerization activity; sequence-specific DNA binding; transcription factor activity; transcription factor binding