Recombinant Human CECR1 protein(254-453aa), His-GST&Myc-tagged

• Cat.No.: CECR1-5489H
• Product Overview: Recombinant Human CECR1 protein(Q9NZK5)(254-453aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His&Myc
• Protein Length: 254-453aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 57.5 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: ELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSY

Gene Information

• Gene Name: CECR1 cat eye syndrome chromosome region, candidate 1 [ Homo sapiens ]
• Official Symbol: CECR1
• Synonyms: CECR1; cat eye syndrome chromosome region, candidate 1; IDGFL; adenosine deaminase CECR1; ADGF; adenosine deaminase 2; cat eye syndrome critical region protein 1; ADA2
• Gene ID: 51816
• mRNA Refseq: NM_017424
• Protein Refseq: NP_059120
• MIM: 607575
• UniProt ID: Q9NZK5