Recombinant Human CECR1 protein(254-453aa), His-GST&Myc-tagged
Cat.No. : | CECR1-5489H |
Product Overview : | Recombinant Human CECR1 protein(Q9NZK5)(254-453aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 254-453aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSY |
Gene Name | CECR1 cat eye syndrome chromosome region, candidate 1 [ Homo sapiens ] |
Official Symbol | CECR1 |
Synonyms | CECR1; cat eye syndrome chromosome region, candidate 1; IDGFL; adenosine deaminase CECR1; ADGF; adenosine deaminase 2; cat eye syndrome critical region protein 1; ADA2; |
Gene ID | 51816 |
mRNA Refseq | NM_017424 |
Protein Refseq | NP_059120 |
MIM | 607575 |
UniProt ID | Q9NZK5 |
◆ Recombinant Proteins | ||
CECR1-5489H | Recombinant Human CECR1 protein(254-453aa), His-GST&Myc-tagged | +Inquiry |
CECR1-255H | Recombinant Human CECR1 protein, His-tagged | +Inquiry |
CECR1-68H | Recombinant Human CECR1 protein, His-tagged | +Inquiry |
CECR1-11089H | Recombinant Human CECR1, GST-tagged | +Inquiry |
CECR1-3156P | Recombinant Pig CECR1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CECR1-001HCL | Recombinant Human CECR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CECR1 Products
Required fields are marked with *
My Review for All CECR1 Products
Required fields are marked with *