Recombinant Human CELSR2 protein, His-tagged
Cat.No. : | CELSR2-3971H |
Product Overview : | Recombinant Human CELSR2 protein(1610-1755 aa), fused to His tag, was expressed in E. coli. |
Availability | August 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1610-1755 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAQEMANPQHFLGSSLVAWHGLSLPISQPWYLSLMFRTRQADGVLLQAITRGRSTITLQLREGHVMLSVEGTGLQASSLRLEPGRANDGDWHHAQLALGASGGPGHAILSFDYGQQRAEGNLGPRLHGLHLSNITVGGIPGPAGGVA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CELSR2 cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila) [ Homo sapiens ] |
Official Symbol | CELSR2 |
Synonyms | CELSR2; cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila); cadherin, EGF LAG seven pass G type receptor 2, flamingo (Drosophila) homolog , EGFL2; cadherin EGF LAG seven-pass G-type receptor 2; CDHF10; Flamingo1; KIAA0279; MEGF3; EGF-like protein 2; flamingo homolog 3; cadherin family member 10; EGF-like-domain, multiple 2; epidermal growth factor-like 2; multiple EGF-like domains protein 3; epidermal growth factor-like protein 2; multiple epidermal growth factor-like domains 3; multiple epidermal growth factor-like domains protein 3; EGFL2; FLJ34118; FLJ42737; FLJ45143; FLJ45845; |
Gene ID | 1952 |
mRNA Refseq | NM_001408 |
Protein Refseq | NP_001399 |
MIM | 604265 |
UniProt ID | Q9HCU4 |
◆ Recombinant Proteins | ||
CELSR2-3971H | Recombinant Human CELSR2 protein, His-tagged | +Inquiry |
CELSR2-2653H | Recombinant Human CELSR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Celsr2-358R | Recombinant Rat Celsr2 protein, His-tagged | +Inquiry |
CELSR2-685H | Recombinant Human CELSR2 | +Inquiry |
CELSR2-18H | Recombinant Human CELSR2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELSR2 Products
Required fields are marked with *
My Review for All CELSR2 Products
Required fields are marked with *