Recombinant Human CENPH, His-tagged

• Cat.No.: CENPH-26924TH
• Product Overview: Recombinant fragment corresponding to amino acids 136-247 of Human CENPH with an N terminal His tag; 133 amino acids with tag, Predicted MWt 15.5 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 112 amino acids
• Description: Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex.
• Conjugation: HIS
• Molecular Weight: 15.500kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
• Sequence Similarities: Belongs to the centromere protein H family.

Gene Information

• Gene Name: CENPH centromere protein H [ Homo sapiens ]
• Official Symbol: CENPH
• Synonyms: CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1
• Gene ID: 64946
• mRNA Refseq: NM_022909
• Protein Refseq: NP_075060
• MIM: 605607
• Uniprot ID: Q9H3R5
• Chromosome Location: 5p15.2
• Pathway: Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; M Phase, organism-specific biosystem
• Function: kinetochore binding; protein binding