Recombinant Human CENPW Protein, GST-tagged
Cat.No. : | CENPW-5253H |
Product Overview : | Human CENPW full-length ORF (NP_001012525.1, 1 a.a. - 88 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CENPW (Centromere Protein W) is a Protein Coding gene. Among its related pathways are Chromosome Maintenance and Cell Cycle, Mitotic. GO annotations related to this gene include protein heterodimerization activity. |
Molecular Mass : | 36.08 kDa |
AA Sequence : | MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CENPW centromere protein W [ Homo sapiens (human) ] |
Official Symbol | CENPW |
Synonyms | CENPW; centromere protein W; CUG2; CENP-W; C6orf173; centromere protein W; cancer-up-regulated gene 2 protein; cancer-upregulated gene 2 |
Gene ID | 387103 |
mRNA Refseq | NM_001012507 |
Protein Refseq | NP_001012525 |
MIM | 611264 |
UniProt ID | Q5EE01 |
◆ Recombinant Proteins | ||
CENPW-5101C | Recombinant Chicken CENPW | +Inquiry |
CENPW-3912HF | Recombinant Full Length Human CENPW Protein, GST-tagged | +Inquiry |
CENPW-2654H | Recombinant Human CENPW Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPW-2725H | Recombinant Human CENPW protein, His-tagged | +Inquiry |
CENPW-1338R | Recombinant Rat CENPW Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPW-7990HCL | Recombinant Human C6orf173 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPW Products
Required fields are marked with *
My Review for All CENPW Products
Required fields are marked with *