Recombinant Human CENPX Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CENPX-6379H
Product Overview : STRA13 MS Standard C13 and N15-labeled recombinant protein (NP_659435) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CENPX (Centromere Protein X) is a Protein Coding gene. Among its related pathways are Chromosome Maintenance and Cell Cycle, Mitotic.
Molecular Mass : 7 kDa
AA Sequence : MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRADVDQLEKVLPQLLLDFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CENPX centromere protein X [ Homo sapiens (human) ]
Official Symbol CENPX
Synonyms CENPX; centromere protein X; D9; MHF2; CENP-X; FAAP10; STRA13; centromere protein X; FANCM associated histone fold protein 2; FANCM-interacting histone fold protein 2; Fanconi anemia-associated polypeptide of 10 kDa; retinoic acid-inducible gene D9 protein homolog; stimulated by retinoic acid 13 homolog; stimulated by retinoic acid gene 13 protein homolog
Gene ID 201254
mRNA Refseq NM_144998
Protein Refseq NP_659435
MIM 615128
UniProt ID A8MT69

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CENPX Products

Required fields are marked with *

My Review for All CENPX Products

Required fields are marked with *

0
cart-icon
0
compare icon