Recombinant Human CENPX Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CENPX-6379H
• Product Overview: STRA13 MS Standard C13 and N15-labeled recombinant protein (NP_659435) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CENPX (Centromere Protein X) is a Protein Coding gene. Among its related pathways are Chromosome Maintenance and Cell Cycle, Mitotic.
• Molecular Mass: 7 kDa
• AA Sequence: MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRADVDQLEKVLPQLLLDFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CENPX centromere protein X [ Homo sapiens (human) ]
• Official Symbol: CENPX
• Synonyms: CENPX; centromere protein X; D9; MHF2; CENP-X; FAAP10; STRA13; centromere protein X; FANCM associated histone fold protein 2; FANCM-interacting histone fold protein 2; Fanconi anemia-associated polypeptide of 10 kDa; retinoic acid-inducible gene D9 protein homolog; stimulated by retinoic acid 13 homolog; stimulated by retinoic acid gene 13 protein homolog
• Gene ID: 201254
• mRNA Refseq: NM_144998
• Protein Refseq: NP_659435
• MIM: 615128
• UniProt ID: A8MT69