Recombinant Human CENPX Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CENPX-6379H |
Product Overview : | STRA13 MS Standard C13 and N15-labeled recombinant protein (NP_659435) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CENPX (Centromere Protein X) is a Protein Coding gene. Among its related pathways are Chromosome Maintenance and Cell Cycle, Mitotic. |
Molecular Mass : | 7 kDa |
AA Sequence : | MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRADVDQLEKVLPQLLLDFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CENPX centromere protein X [ Homo sapiens (human) ] |
Official Symbol | CENPX |
Synonyms | CENPX; centromere protein X; D9; MHF2; CENP-X; FAAP10; STRA13; centromere protein X; FANCM associated histone fold protein 2; FANCM-interacting histone fold protein 2; Fanconi anemia-associated polypeptide of 10 kDa; retinoic acid-inducible gene D9 protein homolog; stimulated by retinoic acid 13 homolog; stimulated by retinoic acid gene 13 protein homolog |
Gene ID | 201254 |
mRNA Refseq | NM_144998 |
Protein Refseq | NP_659435 |
MIM | 615128 |
UniProt ID | A8MT69 |
◆ Recombinant Proteins | ||
CENPX-6379H | Recombinant Human CENPX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CENPX-3179H | Recombinant Human CENPX Protein, MYC/DDK-tagged | +Inquiry |
Cenpx-2110M | Recombinant Mouse Cenpx Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPX Products
Required fields are marked with *
My Review for All CENPX Products
Required fields are marked with *