Recombinant Human CEP120 Protein, GST-Tagged
Cat.No. : | CEP120-1131H |
Product Overview : | Human CEP120 full-length ORF (AAH40527.1, 1 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that functions in the microtubule-dependent coupling of the nucleus and the centrosome. A similar protein in mouse plays a role in both interkinetic nuclear migration, which is a characteristic pattern of nuclear movement in neural progenitors, and in neural progenitor self-renewal. Mutations in this gene are predicted to result in neurogenic defects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 69.1 kDa |
AA Sequence : | MVSKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRLQRTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETDTKPPVDSFKAKGAPPRDGKVPAILAGLDPRDIVAVLNEEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDSQDAFWYSALDIIFPLFIFLFLVLDAIRKFANYEEK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEP120 centrosomal protein 120kDa [ Homo sapiens ] |
Official Symbol | CEP120 |
Synonyms | CCDC100 |
Gene ID | 153241 |
mRNA Refseq | NM_153223 |
Protein Refseq | NP_694955 |
MIM | 613446 |
UniProt ID | Q8N960 |
◆ Recombinant Proteins | ||
CEP120-1131H | Recombinant Human CEP120 Protein, GST-Tagged | +Inquiry |
CEP120-3297M | Recombinant Mouse CEP120 Protein | +Inquiry |
CEP120-3155HF | Recombinant Full Length Human CEP120 Protein, GST-tagged | +Inquiry |
CEP120-1586M | Recombinant Mouse CEP120 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEP120 Products
Required fields are marked with *
My Review for All CEP120 Products
Required fields are marked with *