Recombinant Human CEP164 Protein, GST-tagged
Cat.No. : | CEP164-108H |
Product Overview : | Recombinant Human CEP164 Protien(NP_055771)(1-112 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-112 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKLSTSGAIKKK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | CEP164 centrosomal protein 164kDa [ Homo sapiens ] |
Official Symbol | CEP164 |
Synonyms | CEP164; centrosomal protein 164kDa; centrosomal protein of 164 kDa; KIAA1052; FLJ54767; |
Gene ID | 22897 |
mRNA Refseq | NM_014956 |
Protein Refseq | NP_055771 |
UniProt ID | Q9UPV0 |
◆ Recombinant Proteins | ||
CEP164-2655H | Recombinant Human CEP164 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEP164-11108H | Recombinant Human CEP164, His-tagged | +Inquiry |
CEP164-108H | Recombinant Human CEP164 Protein, GST-tagged | +Inquiry |
CEP164-1259H | Recombinant Human CEP164 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEP164 Products
Required fields are marked with *
My Review for All CEP164 Products
Required fields are marked with *