Recombinant Human CEP20 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CEP20-1488H |
Product Overview : | C16orf63 MS Standard C13 and N15-labeled recombinant protein (NP_653201) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CEP20 (Centrosomal Protein 20) is a Protein Coding gene. Diseases associated with CEP20 include Angular Cheilitis. |
Molecular Mass : | 19.8 kDa |
AA Sequence : | MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CEP20 centrosomal protein 20 [ Homo sapiens (human) ] |
Official Symbol | CEP20 |
Synonyms | CEP20; centrosomal protein 20; FOPNL; FOR20; C16orf63; PHSECRG2; centrosomal protein 20; FGFR1OP N-terminal like; FOP-related protein of 20 kDa; lisH domain-containing protein C16orf63; lisH domain-containing protein FOPNL; pluripotent embryonic stem cell-related protein |
Gene ID | 123811 |
mRNA Refseq | NM_144600 |
Protein Refseq | NP_653201 |
MIM | 617149 |
UniProt ID | Q96NB1 |
◆ Recombinant Proteins | ||
CEP20-7966H | Recombinant Human CEP20 protein, His-tagged | +Inquiry |
CEP20-7965H | Recombinant Human CEP20 protein, GST-tagged | +Inquiry |
Cep20-3068M | Recombinant Mouse Cep20 Protein, Myc/DDK-tagged | +Inquiry |
CEP20-1488H | Recombinant Human CEP20 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEP20 Products
Required fields are marked with *
My Review for All CEP20 Products
Required fields are marked with *
0
Inquiry Basket