Recombinant Human CEP20 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CEP20-1488H
Product Overview : C16orf63 MS Standard C13 and N15-labeled recombinant protein (NP_653201) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CEP20 (Centrosomal Protein 20) is a Protein Coding gene. Diseases associated with CEP20 include Angular Cheilitis.
Molecular Mass : 19.8 kDa
AA Sequence : MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CEP20 centrosomal protein 20 [ Homo sapiens (human) ]
Official Symbol CEP20
Synonyms CEP20; centrosomal protein 20; FOPNL; FOR20; C16orf63; PHSECRG2; centrosomal protein 20; FGFR1OP N-terminal like; FOP-related protein of 20 kDa; lisH domain-containing protein C16orf63; lisH domain-containing protein FOPNL; pluripotent embryonic stem cell-related protein
Gene ID 123811
mRNA Refseq NM_144600
Protein Refseq NP_653201
MIM 617149
UniProt ID Q96NB1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CEP20 Products

Required fields are marked with *

My Review for All CEP20 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon