Recombinant Human CEP250 Protein, GST-Tagged

Cat.No. : CEP250-1132H
Product Overview : Human CEP2 partial ORF (AAH01433, 141 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a core centrosomal protein required for centriole-centriole cohesion during interphase of the cell cycle. The encoded protein dissociates from the centrosomes when parental centrioles separate at the beginning of mitosis. The protein associates with and is phosphorylated by NIMA-related kinase 2, which is also associated with the centrosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
Molecular Mass : 36.63 kDa
AA Sequence : LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CEP250 centrosomal protein 250kDa [ Homo sapiens ]
Official Symbol CEP250
Synonyms CEP250; centrosomal protein 250kDa; centrosomal protein 2, CEP2; centrosome-associated protein CEP250; C NAP1; 250 kDa centrosomal protein; centrosomal protein, 250-KD; centrosome associated protein; centrosomal Nek2-associated protein 1; CEP2; CNAP1; C-NAP1; MGC88542;
Gene ID 11190
mRNA Refseq NM_007186
Protein Refseq NP_009117
MIM 609689
UniProt ID Q9BV73

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEP250 Products

Required fields are marked with *

My Review for All CEP250 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon