Recombinant Human CEP250 Protein, GST-Tagged
Cat.No. : | CEP250-1132H |
Product Overview : | Human CEP2 partial ORF (AAH01433, 141 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a core centrosomal protein required for centriole-centriole cohesion during interphase of the cell cycle. The encoded protein dissociates from the centrosomes when parental centrioles separate at the beginning of mitosis. The protein associates with and is phosphorylated by NIMA-related kinase 2, which is also associated with the centrosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEP250 centrosomal protein 250kDa [ Homo sapiens ] |
Official Symbol | CEP250 |
Synonyms | CEP250; centrosomal protein 250kDa; centrosomal protein 2, CEP2; centrosome-associated protein CEP250; C NAP1; 250 kDa centrosomal protein; centrosomal protein, 250-KD; centrosome associated protein; centrosomal Nek2-associated protein 1; CEP2; CNAP1; C-NAP1; MGC88542; |
Gene ID | 11190 |
mRNA Refseq | NM_007186 |
Protein Refseq | NP_009117 |
MIM | 609689 |
UniProt ID | Q9BV73 |
◆ Recombinant Proteins | ||
CEP250-1132H | Recombinant Human CEP250 Protein, GST-Tagged | +Inquiry |
CEP250-3397H | Recombinant Human CEP250 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEP250 Products
Required fields are marked with *
My Review for All CEP250 Products
Required fields are marked with *
0
Inquiry Basket