Recombinant Human CERCAM Protein, GST-Tagged
| Cat.No. : | CERCAM-1146H |
| Product Overview : | Human CEECAM1 full-length ORF (NP_057258.2, 1 a.a. - 517 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CERCAM (Cerebral Endothelial Cell Adhesion Molecule) is a Protein Coding gene. An important paralog of this gene is COLGALT1. |
| Molecular Mass : | 85.5 kDa |
| AA Sequence : | MLQEWLAAVGDDYAAVVWRPEGEPRFYPDEEGPKHWTKERHQFLMELKQEALTFARNWGADYILFADTDNILTNNQTLRLLMGQGLPVVAPMLDSQTYYSNFWCGITPQGYYRRTAEYFPTKNRQRRGCFRVPMVHSTFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDGPRMQASAHVTRPSKRPSKIGFDEVFVISLARRPDRRERMLASLWEMEISGRVVDAVDGWMLNSSAIRNLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVARGLARVLVFEDDVRFESNFRGRLERLMEDVEAEKLSWDLIYLGRKQVNPEKETAVEGLPGLVVAGYSYWTLAYALRLAGARKLLASQPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDDSGRLISWSGSQKTLRSPRLDLTGSSGHSLQPQPRDEL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CERCAM cerebral endothelial cell adhesion molecule [ Homo sapiens ] |
| Official Symbol | CERCAM |
| Synonyms | CERCAM; cerebral endothelial cell adhesion molecule; CEECAM1, cerebral cell adhesion molecule; glycosyltransferase 25 family member 3; CerCAM; GLT25D3; glycosyltransferase 25 domain containing 3; cerebral cell adhesion molecule; cerebral endothelial cell adhesion molecule 1; CEECAM1; MGC149620; MGC149621; |
| Gene ID | 51148 |
| mRNA Refseq | NM_016174 |
| Protein Refseq | NP_057258 |
| MIM | 616626 |
| UniProt ID | Q5T4B2 |
| ◆ Recombinant Proteins | ||
| CERCAM-3247HF | Recombinant Full Length Human CERCAM Protein, GST-tagged | +Inquiry |
| CERCAM-1146H | Recombinant Human CERCAM Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CERCAM-332HCL | Recombinant Human CERCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CERCAM Products
Required fields are marked with *
My Review for All CERCAM Products
Required fields are marked with *



