Recombinant Human cerebellin 4 precursor Protein, His tagged
Cat.No. : | CBLN4-001H |
Product Overview : | Recombinant human cerebellin 4 precursor Protein (28-201 aa) with C-His tag was expressed in baculovirus-insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 28-201aa |
Description : | This gene encodes a member of a family of small secreted proteins containing C1Q domains. Members of this family are involved in regulation of neurexin signalling during synapse development. The mouse homolog of the protein encoded by this gene competes with netrin to bind to the deleted in colorectal cancer receptor. |
Tag : | C-His |
Molecular Mass : | 20 kDa |
AA Sequence : | MQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPLHHHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH 7.4 |
Concentration : | 1 mg/mL by BCA |
Gene Name | CBLN4 cerebellin 4 precursor [ Homo sapiens (human) ] |
Official Symbol | CBLN4 |
Synonyms | CBLN4; cerebellin 4 precursor; CBLNL1, cerebellin precursor like 1; cerebellin-4; dJ885A10.1; cerebellin precursor-like 1; cerebellin-like glycoprotein 1; CBLNL1; |
Gene ID | 140689 |
mRNA Refseq | NM_080617 |
Protein Refseq | NP_542184 |
MIM | 615029 |
UniProt ID | Q9NTU7 |
◆ Recombinant Proteins | ||
CBLN4-2772HF | Recombinant Full Length Human CBLN4 Protein, GST-tagged | +Inquiry |
CBLN4-3526C | Recombinant Chicken CBLN4 | +Inquiry |
CBLN4-6153Z | Recombinant Zebrafish CBLN4 | +Inquiry |
CBLN4-0466H | Recombinant Human CBLN4 Protein, GST-Tagged | +Inquiry |
CBLN4-643R | Recombinant Rhesus monkey CBLN4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CBLN4-07H | Recombinant Human CBLN4 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBLN4 Products
Required fields are marked with *
My Review for All CBLN4 Products
Required fields are marked with *