Recombinant Human CETN2, His-tagged

• Cat.No.: CETN2-27957TH
• Product Overview: Recombinant full length Human Centrin 2 with an N terminal His tag; 192 amino acids with tag, Predicted MWt 21.9 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 172 amino acids
• Description: Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome.The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.
• Conjugation: HIS
• Molecular Weight: 21.900kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASNFKKANMASSSQRKRMS PKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEK DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
• Sequence Similarities: Belongs to the centrin family.Contains 4 EF-hand domains.

Gene Information

• Gene Name: CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ]
• Official Symbol: CETN2
• Synonyms: CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2
• Gene ID: 1069
• mRNA Refseq: NM_004344
• Protein Refseq: NP_004335
• MIM: 300006
• Uniprot ID: P41208
• Chromosome Location: Xq28
• Pathway: Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem
• Function: ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding