Recombinant Human CETN2, His-tagged
Cat.No. : | CETN2-27957TH |
Product Overview : | Recombinant full length Human Centrin 2 with an N terminal His tag; 192 amino acids with tag, Predicted MWt 21.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 172 amino acids |
Description : | Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome.The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. |
Conjugation : | HIS |
Molecular Weight : | 21.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASNFKKANMASSSQRKRMS PKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEK DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
Sequence Similarities : | Belongs to the centrin family.Contains 4 EF-hand domains. |
Gene Name | CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ] |
Official Symbol | CETN2 |
Synonyms | CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; |
Gene ID | 1069 |
mRNA Refseq | NM_004344 |
Protein Refseq | NP_004335 |
MIM | 300006 |
Uniprot ID | P41208 |
Chromosome Location | Xq28 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem; |
Function | ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding; |
◆ Recombinant Proteins | ||
CETN2-754H | Recombinant Human CETN2 Protein, His-tagged | +Inquiry |
CETN2-3339M | Recombinant Mouse CETN2 Protein | +Inquiry |
CETN2-650R | Recombinant Rhesus Macaque CETN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CETN2-1812H | Recombinant Human CETN2 protein, GST-tagged | +Inquiry |
CETN2-118H | Recombinant Human CETN2, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CETN2 Products
Required fields are marked with *
My Review for All CETN2 Products
Required fields are marked with *
0
Inquiry Basket