Recombinant Human CFAP157 Protein, GST-Tagged
| Cat.No. : | CFAP157-0182H |
| Product Overview : | Human C9orf117 full-length ORF (1 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CFAP157 (Cilia And Flagella Associated Protein 157) is a Protein Coding gene. |
| Molecular Mass : | 56.2 kDa |
| AA Sequence : | MGTEVGISWTRVGTGATVGLLPPHPHQQMHRDEEDSDVDVTFQPWHKEMLQQLLVMLSSTVATRPQKAACPHQESQSHGPPKESRPSIQLPRTGSLLPQLSDITPYQPGDLGLVPRQVHIPPNPQDLRLLSSITRVGTFRAHSSPEQGKSGIPLKRPQLPSQHLSFFFFFFFFLRQSLTLSPRLECSATISAHSNLRLPGSSDSPASVSQVAGITGMHHHAWLLFVFLVETGFHHVGQAGLELLTSSNPPASASQSAGIIGVSHCTRPPSQHL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CFAP157 cilia and flagella associated protein 157 [ Homo sapiens (human) ] |
| Official Symbol | CFAP157 |
| Synonyms | CFAP157; cilia and flagella associated protein 157; C9ORF117; chromosome 9 open reading frame 117; uncharacterized protein C9orf117; RP11-56D16.5; |
| Gene ID | 286207 |
| mRNA Refseq | NM_001012502 |
| Protein Refseq | NP_001012520 |
| UniProt ID | Q5JU67 |
| ◆ Recombinant Proteins | ||
| CFAP157-0182H | Recombinant Human CFAP157 Protein, GST-Tagged | +Inquiry |
| CFAP157-2682HF | Recombinant Full Length Human CFAP157 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFAP157 Products
Required fields are marked with *
My Review for All CFAP157 Products
Required fields are marked with *
