Recombinant Human CFC1 Protein, GST-Tagged
Cat.No. : | CFC1-1163H |
Product Overview : | Human CFC1 full-length ORF (NP_115934.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family, which are involved in signalling during embryonic development. Proteins in this family share a variant EGF-like motif, a conserved cysteine-rich domain, and a C-terminal hydrophobic region. The protein encoded by this gene is necessary for patterning the left-right embryonic axis. Mutations in this gene are associated with defects in organ development, including autosomal visceral heterotaxy and congenital heart disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 51 kDa |
AA Sequence : | MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLLLLPCALLHRLLRPDAPAHPRSLVPSVLQRERRPCGRPGLGHRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFC1 cripto, FRL-1, cryptic family 1 [ Homo sapiens ] |
Official Symbol | CFC1 |
Synonyms | CFC1; cripto, FRL-1, cryptic family 1; cryptic protein; CRYPTIC; HTX2; cryptic family protein 1; CFC1B; DTGA2; FLJ77897; MGC133213; |
Gene ID | 55997 |
mRNA Refseq | NM_032545 |
Protein Refseq | NP_115934 |
MIM | 605194 |
UniProt ID | P0CG37 |
◆ Recombinant Proteins | ||
CFC1-652R | Recombinant Rhesus Macaque CFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFC1-3343M | Recombinant Mouse CFC1 Protein | +Inquiry |
CFC1-3293HF | Recombinant Full Length Human CFC1 Protein, GST-tagged | +Inquiry |
CFC1-2162H | Recombinant Human CFC1 Protein (Met1-Gly169), C-His tagged | +Inquiry |
CFC1-1163H | Recombinant Human CFC1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFC1-339HCL | Recombinant Human CFC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFC1 Products
Required fields are marked with *
My Review for All CFC1 Products
Required fields are marked with *