Recombinant Human CFDP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CFDP1-1119H
• Product Overview: CFDP1 MS Standard C13 and N15-labeled recombinant protein (NP_006315) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CFDP1 (Craniofacial Development Protein 1) is a Protein Coding gene. Diseases associated with CFDP1 include Pthirus Pubis Infestation and Lice Infestation.
• Molecular Mass: 33.6 kDa
• AA Sequence: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CFDP1 craniofacial development protein 1 [ Homo sapiens (human) ]
• Official Symbol: CFDP1
• Synonyms: CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR
• Gene ID: 10428
• mRNA Refseq: NM_006324
• Protein Refseq: NP_006315
• MIM: 608108
• UniProt ID: Q9UEE9