Recombinant Human CFDP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CFDP1-1119H |
| Product Overview : | CFDP1 MS Standard C13 and N15-labeled recombinant protein (NP_006315) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | CFDP1 (Craniofacial Development Protein 1) is a Protein Coding gene. Diseases associated with CFDP1 include Pthirus Pubis Infestation and Lice Infestation. |
| Molecular Mass : | 33.6 kDa |
| AA Sequence : | MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CFDP1 craniofacial development protein 1 [ Homo sapiens (human) ] |
| Official Symbol | CFDP1 |
| Synonyms | CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR; |
| Gene ID | 10428 |
| mRNA Refseq | NM_006324 |
| Protein Refseq | NP_006315 |
| MIM | 608108 |
| UniProt ID | Q9UEE9 |
| ◆ Recombinant Proteins | ||
| CFDP1-1166H | Recombinant Human CFDP1 Protein, GST-Tagged | +Inquiry |
| CFDP1-301301H | Recombinant Human CFDP1 protein, GST-tagged | +Inquiry |
| Cfdp1-2131M | Recombinant Mouse Cfdp1 Protein, Myc/DDK-tagged | +Inquiry |
| CFDP1-1611M | Recombinant Mouse CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CFDP1-3345M | Recombinant Mouse CFDP1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFDP1-7557HCL | Recombinant Human CFDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFDP1 Products
Required fields are marked with *
My Review for All CFDP1 Products
Required fields are marked with *
