Recombinant Human CFDP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CFDP1-1119H
Product Overview : CFDP1 MS Standard C13 and N15-labeled recombinant protein (NP_006315) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CFDP1 (Craniofacial Development Protein 1) is a Protein Coding gene. Diseases associated with CFDP1 include Pthirus Pubis Infestation and Lice Infestation.
Molecular Mass : 33.6 kDa
AA Sequence : MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CFDP1 craniofacial development protein 1 [ Homo sapiens (human) ]
Official Symbol CFDP1
Synonyms CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR;
Gene ID 10428
mRNA Refseq NM_006324
Protein Refseq NP_006315
MIM 608108
UniProt ID Q9UEE9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFDP1 Products

Required fields are marked with *

My Review for All CFDP1 Products

Required fields are marked with *

0
cart-icon