Recombinant Human CFHR1 protein, GST-tagged

Cat.No. : CFHR1-27138TH
Product Overview : Recombinant Human CFHR1(19 a.a. - 330 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 19-330 a.a.
Description : This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 60.06 kDa
AA Sequence : EATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVE NGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPS GERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQL EGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCW DGKLEYPTCAKR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CFHR1 complement factor H-related 1 [ Homo sapiens ]
Official Symbol CFHR1
Synonyms CFHR1; complement factor H-related 1; CFHL1, CFHL1P, CFHR1P, complement factor H related 1 pseudogene , H factor (complement) like 1 , H factor (complement) like 2 , HFL1, HFL2; complement factor H-related protein 1; CFHL; FHR1; H36 1; H36 2; H36; FHR-1; H-factor-like 1; h factor-like protein 1; H factor (complement)-like 1; H factor (complement)-like 2; complement factor H-related 1 pseudogene; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P; MGC104329;
Gene ID 3078
mRNA Refseq NM_002113
Protein Refseq NP_002104
MIM 134371
UniProt ID Q03591
Chromosome Location 1q32

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CFHR1 Products

Required fields are marked with *

My Review for All CFHR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon