Recombinant Human CFL2
| Cat.No. : | CFL2-26779TH |
| Product Overview : | Recombinant full length Human Cofilin 2 with N terminal proprietary tag; Predicted MWt 44.33 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 166 amino acids |
| Description : | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. |
| Molecular Weight : | 44.330kDa inclusive of tags |
| Tissue specificity : | Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCL SDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL |
| Sequence Similarities : | Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain. |
| Gene Name | CFL2 cofilin 2 (muscle) [ Homo sapiens ] |
| Official Symbol | CFL2 |
| Synonyms | CFL2; cofilin 2 (muscle); cofilin-2; |
| Gene ID | 1073 |
| mRNA Refseq | NM_001243645 |
| Protein Refseq | NP_001230574 |
| MIM | 601443 |
| Uniprot ID | Q9Y281 |
| Chromosome Location | 14q13.2 |
| Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem; |
| Function | actin binding; protein binding; |
| ◆ Recombinant Proteins | ||
| CFL2-2466HF | Active Recombinant Full Length Human CFL2 Protein, GST-tagged | +Inquiry |
| CFL2-3351M | Recombinant Mouse CFL2 Protein | +Inquiry |
| CFL2-1224C | Recombinant Chicken CFL2 | +Inquiry |
| CFL2-1174H | Recombinant Human CFL2 Protein, GST-Tagged | +Inquiry |
| Cfl2-881M | Recombinant Mouse Cfl2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFL2-7554HCL | Recombinant Human CFL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFL2 Products
Required fields are marked with *
My Review for All CFL2 Products
Required fields are marked with *



