Recombinant Human CFP

Cat.No. : CFP-29037TH
Product Overview : Recombinant fragment of Human Properdin with a N terminal proprietary tag; Predicted MWt 39.05 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 122 amino acids
Description : This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Molecular Weight : 39.050kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLP PCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHG GPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNM KS
Sequence Similarities : Contains 6 TSP type-1 domains.
Gene Name CFP complement factor properdin [ Homo sapiens ]
Official Symbol CFP
Synonyms CFP; complement factor properdin; PFC, properdin P factor, complement; properdin;
Gene ID 5199
mRNA Refseq NM_001145252
Protein Refseq NP_001138724
MIM 300383
Uniprot ID P27918
Chromosome Location Xp11.4
Pathway Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFP Products

Required fields are marked with *

My Review for All CFP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon