Recombinant Human CFP
Cat.No. : | CFP-29037TH |
Product Overview : | Recombinant fragment of Human Properdin with a N terminal proprietary tag; Predicted MWt 39.05 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 122 amino acids |
Description : | This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Molecular Weight : | 39.050kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLP PCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHG GPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNM KS |
Sequence Similarities : | Contains 6 TSP type-1 domains. |
Gene Name | CFP complement factor properdin [ Homo sapiens ] |
Official Symbol | CFP |
Synonyms | CFP; complement factor properdin; PFC, properdin P factor, complement; properdin; |
Gene ID | 5199 |
mRNA Refseq | NM_001145252 |
Protein Refseq | NP_001138724 |
MIM | 300383 |
Uniprot ID | P27918 |
Chromosome Location | Xp11.4 |
Pathway | Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
◆ Recombinant Proteins | ||
Cfp-5378M | Recombinant Mouse Cfp protein, His-Myc-tagged | +Inquiry |
CFP-2152M | Recombinant Mouse CFP Protein (23-464 aa), His-tagged | +Inquiry |
CFP-901H | Recombinant Human CFP protein, His-tagged | +Inquiry |
CFP-29037TH | Recombinant Human CFP | +Inquiry |
CFP-3299HF | Recombinant Full Length Human CFP Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFP-7552HCL | Recombinant Human CFP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFP Products
Required fields are marked with *
My Review for All CFP Products
Required fields are marked with *
0
Inquiry Basket