Recombinant Human CFP Protein, GST-Tagged
Cat.No. : | CFP-1179H |
Product Overview : | Human CFP full-length ORF (AAH15756.1, 1 a.a. - 469 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.[provided by RefSeq, Feb 2009] |
Molecular Mass : | 77.33 kDa |
AA Sequence : | MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFP complement factor properdin [ Homo sapiens ] |
Official Symbol | CFP |
Synonyms | CFP; complement factor properdin; PFC, properdin P factor, complement; properdin; complement factor P; properdin P factor, complement; BFD; PFC; PFD; PROPERDIN; |
Gene ID | 5199 |
mRNA Refseq | NM_001145252 |
Protein Refseq | NP_001138724 |
MIM | 300383 |
UniProt ID | P27918 |
◆ Recombinant Proteins | ||
CFP-1352H | Recombinant Human CFP Protein (Gln65-Cys190), N-His tagged | +Inquiry |
CFP-210M | Recombinant Mouse CFP protein, His-tagged | +Inquiry |
CFP-252H | Recombinant Human CFP, His-tagged | +Inquiry |
CFP-3299HF | Recombinant Full Length Human CFP Protein, GST-tagged | +Inquiry |
CFP-002E | Recombinant Cyan Fluorescent Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFP-7552HCL | Recombinant Human CFP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFP Products
Required fields are marked with *
My Review for All CFP Products
Required fields are marked with *
0
Inquiry Basket