Recombinant Human CFTR

Cat.No. : CFTR-27241TH
Product Overview : Recombinant fragment of Human CFTR (amino acids 1381-1480) with N terminal proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily that is involved in multi-drug resistance. The encoded protein functions as a chloride channel and controls the regulation of other transport pathways. Mutations in this gene are associated with the autosomal recessive disorders cystic fibrosis and congenital bilateral aplasia of the vas deferens. Alternatively spliced transcript variants have been described, many of which result from mutations in this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Found on the surface of the epithelial cells that line the lungs and other organs.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL
Sequence Similarities : Belongs to the ABC transporter superfamily. ABCC family. CFTR transporter (TC 3.A.1.202) subfamily.Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains.
Gene Name CFTR cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) [ Homo sapiens ]
Official Symbol CFTR
Synonyms CFTR; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); ABCC7, CF, cystic fibrosis transmembrane conductance regulator, ATP binding cassette (sub family C, member 7); cystic fibrosis transmembrane conducta
Gene ID 1080
mRNA Refseq NM_000492
Protein Refseq NP_000483
MIM 602421
Uniprot ID P13569
Chromosome Location 7q31-q32
Pathway ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem;
Function ATP binding; ATP-binding and phosphorylation-dependent chloride channel activity; ATPase activity; PDZ domain binding; channel-conductance-controlling ATPase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFTR Products

Required fields are marked with *

My Review for All CFTR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon