Recombinant Human CHCHD10 Protein, GST-Tagged
Cat.No. : | CHCHD10-1207H |
Product Overview : | Human CHCHD10 full-length ORF (AAH65232.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a mitochondrial protein that is enriched at cristae junctions in the intermembrane space. It may play a role in cristae morphology maintenance or oxidative phosphorylation. Mutations in this gene cause frontotemporal dementia and/or amyotrophic lateral sclerosis-2. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7 and 19. [provided by RefSeq, Aug 2014] |
Molecular Mass : | 42.02 kDa |
AA Sequence : | MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHCHD10 coiled-coil-helix-coiled-coil-helix domain containing 10 [ Homo sapiens ] |
Official Symbol | CHCHD10 |
Synonyms | N27C7-4; C22orf16 |
Gene ID | 400916 |
mRNA Refseq | NM_213720 |
Protein Refseq | NP_998885 |
MIM | 615903 |
UniProt ID | Q8WYQ3 |
◆ Recombinant Proteins | ||
CHCHD10-11045Z | Recombinant Zebrafish CHCHD10 | +Inquiry |
CHCHD10-1207H | Recombinant Human CHCHD10 Protein, GST-Tagged | +Inquiry |
CHCHD10-3311HF | Recombinant Full Length Human CHCHD10 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHCHD10 Products
Required fields are marked with *
My Review for All CHCHD10 Products
Required fields are marked with *
0
Inquiry Basket