Recombinant Human CHCHD5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CHCHD5-1023H |
Product Overview : | CHCHD5 MS Standard C13 and N15-labeled recombinant protein (NP_115685) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CHCHD5 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 5) is a Protein Coding gene. Diseases associated with CHCHD5 include Sarcocystosis. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. An important paralog of this gene is COX19. |
Molecular Mass : | 12.4 kDa |
AA Sequence : | MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CHCHD5 coiled-coil-helix-coiled-coil-helix domain containing 5 [ Homo sapiens (human) ] |
Official Symbol | CHCHD5 |
Synonyms | CHCHD5; coiled-coil-helix-coiled-coil-helix domain containing 5; C2orf9, chromosome 2 open reading frame 9; coiled-coil-helix-coiled-coil-helix domain-containing protein 5; MGC11104; C2orf9; FLJ39671; |
Gene ID | 84269 |
mRNA Refseq | NM_032309 |
Protein Refseq | NP_115685 |
MIM | 616978 |
UniProt ID | Q9BSY4 |
◆ Recombinant Proteins | ||
CHCHD5-3544H | Recombinant Human CHCHD5 protein, His-tagged | +Inquiry |
CHCHD5-1023H | Recombinant Human CHCHD5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Chchd5-2139M | Recombinant Mouse Chchd5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHCHD5-7544HCL | Recombinant Human CHCHD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHCHD5 Products
Required fields are marked with *
My Review for All CHCHD5 Products
Required fields are marked with *