Recombinant Human CHCHD7 protein, His-tagged
Cat.No. : | CHCHD7-677H |
Product Overview : | Recombinant Human CHCHD7 protein(NP_001011667)(1-97 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-97 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MHQTRTGKKTVRMPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CHCHD7 coiled-coil-helix-coiled-coil-helix domain containing 7 [ Homo sapiens (human) ] |
Official Symbol | CHCHD7 |
Synonyms | COX23 |
Gene ID | 79145 |
mRNA Refseq | NM_001011667 |
Protein Refseq | NP_001011667 |
MIM | 611238 |
UniProt ID | Q9BUK0 |
◆ Recombinant Proteins | ||
CHCHD7-6772Z | Recombinant Zebrafish CHCHD7 | +Inquiry |
CHCHD7-677H | Recombinant Human CHCHD7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHCHD7-7542HCL | Recombinant Human CHCHD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHCHD7 Products
Required fields are marked with *
My Review for All CHCHD7 Products
Required fields are marked with *