Recombinant Human CHD1 Protein, GST-Tagged

Cat.No. : CHD1-1212H
Product Overview : Human CHD1 partial ORF (NP_001261, 1177 a.a. - 1272 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.3 kDa
AA Sequence : IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHD1 chromodomain helicase DNA binding protein 1 [ Homo sapiens ]
Official Symbol CHD1
Synonyms CHD1; chromodomain helicase DNA binding protein 1; chromodomain-helicase-DNA-binding protein 1; CHD-1; ATP-dependent helicase CHD1; DKFZp686E2337;
Gene ID 1105
mRNA Refseq NM_001270
Protein Refseq NP_001261
MIM 602118
UniProt ID O14646

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHD1 Products

Required fields are marked with *

My Review for All CHD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon