Recombinant Human CHD1 Protein, GST-Tagged
Cat.No. : | CHD1-1212H |
Product Overview : | Human CHD1 partial ORF (NP_001261, 1177 a.a. - 1272 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.3 kDa |
AA Sequence : | IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHD1 chromodomain helicase DNA binding protein 1 [ Homo sapiens ] |
Official Symbol | CHD1 |
Synonyms | CHD1; chromodomain helicase DNA binding protein 1; chromodomain-helicase-DNA-binding protein 1; CHD-1; ATP-dependent helicase CHD1; DKFZp686E2337; |
Gene ID | 1105 |
mRNA Refseq | NM_001270 |
Protein Refseq | NP_001261 |
MIM | 602118 |
UniProt ID | O14646 |
◆ Recombinant Proteins | ||
CHD1-1212H | Recombinant Human CHD1 Protein, GST-Tagged | +Inquiry |
CHD1-03H | Recombinant Human CHD1 Protein (268-452), N-His tagged | +Inquiry |
CHD1-6842Z | Recombinant Zebrafish CHD1 | +Inquiry |
CHD1-27812TH | Recombinant Human CHD1 | +Inquiry |
CHD1-6501C | Recombinant Chicken CHD1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHD1 Products
Required fields are marked with *
My Review for All CHD1 Products
Required fields are marked with *
0
Inquiry Basket