Recombinant Human CHD1 Protein, GST-Tagged

• Cat.No.: CHD1-1212H
• Product Overview: Human CHD1 partial ORF (NP_001261, 1177 a.a. - 1272 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.3 kDa
• AA Sequence: IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHD1 chromodomain helicase DNA binding protein 1 [ Homo sapiens ]
• Official Symbol: CHD1
• Synonyms: CHD1; chromodomain helicase DNA binding protein 1; chromodomain-helicase-DNA-binding protein 1; CHD-1; ATP-dependent helicase CHD1; DKFZp686E2337
• Gene ID: 1105
• mRNA Refseq: NM_001270
• Protein Refseq: NP_001261
• MIM: 602118
• UniProt ID: O14646