Recombinant Human CHD1L Protein (704-897 aa), His-SUMO-tagged
Cat.No. : | CHD1L-2043H |
Product Overview : | Recombinant Human CHD1L Protein (704-897 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 704-897 aa |
Description : | DNA helicase which plays a role in chromatin-remodeling following DNA damage. Targeted to sites of DNA damage through interaction with poly(ADP-ribose) and functions to regulate chromatin during DNA repair. Able to catalyze nucleosome sliding in an ATP-dependent manner. Helicase activity is strongly stimulated upon poly(ADP-ribose)-binding. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.3 kDa |
AA Sequence : | SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CHD1L chromodomain helicase DNA binding protein 1-like [ Homo sapiens ] |
Official Symbol | CHD1L |
Synonyms | ALC1; CHDL; |
Gene ID | 9557 |
mRNA Refseq | NM_024568.2 |
Protein Refseq | NP_078844.2 |
MIM | 613039 |
UniProt ID | Q86WJ1 |
◆ Recombinant Proteins | ||
CHD1L-3209H | Recombinant Human CHD1L Protein, MYC/DDK-tagged | +Inquiry |
CHD1L-1630M | Recombinant Mouse CHD1L Protein, His (Fc)-Avi-tagged | +Inquiry |
CHD1L-1334HFL | Recombinant Full Length Human CHD1L Protein, C-Flag-tagged | +Inquiry |
CHD1L-2509H | Recombinant Human CHD1L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CHD1L-10642Z | Recombinant Zebrafish CHD1L | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHD1L Products
Required fields are marked with *
My Review for All CHD1L Products
Required fields are marked with *
0
Inquiry Basket