Recombinant Human CHD1L Protein (704-897 aa), His-SUMO-tagged
| Cat.No. : | CHD1L-2043H |
| Product Overview : | Recombinant Human CHD1L Protein (704-897 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 704-897 aa |
| Description : | DNA helicase which plays a role in chromatin-remodeling following DNA damage. Targeted to sites of DNA damage through interaction with poly(ADP-ribose) and functions to regulate chromatin during DNA repair. Able to catalyze nucleosome sliding in an ATP-dependent manner. Helicase activity is strongly stimulated upon poly(ADP-ribose)-binding. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 37.3 kDa |
| AA Sequence : | SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | CHD1L chromodomain helicase DNA binding protein 1-like [ Homo sapiens ] |
| Official Symbol | CHD1L |
| Synonyms | ALC1; CHDL; |
| Gene ID | 9557 |
| mRNA Refseq | NM_024568.2 |
| Protein Refseq | NP_078844.2 |
| MIM | 613039 |
| UniProt ID | Q86WJ1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHD1L Products
Required fields are marked with *
My Review for All CHD1L Products
Required fields are marked with *



