Recombinant Human CHD7 Protein
Cat.No. : | CHD7-1216H |
Product Overview : | Human CHD7 (P39476, 64 amino acids) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a protein that contains several helicase family domains. Mutations in this gene have been found in some patients with the CHARGE syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015] |
Form : | Lyophlized |
Molecular Mass : | 9.44 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK |
Endotoxin : | < 0.1 EU/μg |
Purity : | >= 99% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | No additive |
Gene Name | CHD7 chromodomain helicase DNA binding protein 7 [ Homo sapiens ] |
Official Symbol | CHD7 |
Synonyms | CHD7; chromodomain helicase DNA binding protein 7; FLJ20357; FLJ20361; KIAA1416; |
Gene ID | 55636 |
mRNA Refseq | NM_017780 |
Protein Refseq | NP_060250 |
MIM | 608892 |
UniProt ID | Q9P2D1 |
◆ Recombinant Proteins | ||
CHD7-4914H | Recombinant Human Chromodomain Helicase DNA Binding Protein 7, His-tagged | +Inquiry |
CHD7-1634M | Recombinant Mouse CHD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHD7-3382M | Recombinant Mouse CHD7 Protein | +Inquiry |
CHD7-1216H | Recombinant Human CHD7 Protein | +Inquiry |
CHD7-08H | Recombinant Human CHD7 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHD7 Products
Required fields are marked with *
My Review for All CHD7 Products
Required fields are marked with *