Recombinant Human CXCL2 Protein, His tagged
| Cat.No. : | CXCL2-224H |
| Product Overview : | Recombinant Human CXCL2 Protein (35-107 aa) with His tag was expressed in E.coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 35-107 aa |
| Description : | This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. |
| Form : | Sterile PBS, pH7.4, 10% Glycerol |
| Molecular Mass : | 10 kDa |
| AASequence : | MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVKVKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.8 mg/mL by BCA |
| Gene Name | CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens (human) ] |
| Official Symbol | CXCL2 |
| Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a |
| Gene ID | 2920 |
| mRNA Refseq | NM_002089 |
| Protein Refseq | NP_002080 |
| MIM | 139110 |
| UniProt ID | P19875 |
| ◆ Recombinant Proteins | ||
| Cxcl2-2395M | Active Recombinant Mouse Cxcl2 Protein | +Inquiry |
| Cxcl2-020C | Active Recombinant Mouse Cxcl2 Protein (73 aa) | +Inquiry |
| CXCL2-1689R | Recombinant Rat CXCL2 Protein | +Inquiry |
| CXCL2-17H | Active Recombinant Human CXCL2 | +Inquiry |
| Cxcl2-626R | Active Recombinant Rat Cxcl2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL2 Products
Required fields are marked with *
My Review for All CXCL2 Products
Required fields are marked with *
