Recombinant Human chemokine (C-X-C motif) ligand 2, His-tagged
Cat.No. : | CXCL2-224H |
Product Overview : | GRO-Beta Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide ch- ain containing 94 amino acids and having a molecular mass of 10.1 kDa. The GRO-b is fused to 20 amino acid His Tag at N-terminus and purified by proprietary chromatographic techniques. |
Availability | September 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human |
Tag : | His |
Description : | Chemokine (C-X-C motif) ligand 2 (CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. This chemokine is secreted by monocytes and macrophages and is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 mobilizes cells by interacting with a cell surface chemokine receptor called CXCR2. |
Form : | The Human CXCL2 protein solution contains 20mM Tris HCl. |
Purity : | Greater than 95.0% as determined by SDS-PAGE. |
Physical Appearance : | Sterile filtered colorless solution. |
Amino acid sequence : | MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVK VKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
Storage : | Lyophilized Bone Morphogenetic Protein-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name | CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ] |
Official Symbol | CXCL2 |
Synonyms | CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a; MIP2-alpha; MIP-2a; Gro-beta; C-X-C motif chemokine 2; GRO2 oncogene; Growth-regulated protein beta; MGSA beta; chemokine (C-X-C motif) ligand 2; melanoma growth stimulatory activity beta; MIP2A_HUMAN; Macrophage inflammatory protein 2-alpha [Precursor]; Gro-beta |
Gene ID | 2920 |
mRNA Refseq | NM_002089 |
Protein Refseq | NP_002080 |
MIM | 139110 |
UniProt ID | P19875 |
Chromosome Location | 4q21 |
Pathway | Cytokine-cytokine receptor interaction |
Function | chemokine activity |
◆ Recombinant Proteins | ||
CXCL2-282H | Recombinant Human CXCL2, StrepII-tagged | +Inquiry |
Cxcl2-395C | Active Recombinant Cotton Rat Cxcl2 | +Inquiry |
Cxcl2-626R | Active Recombinant Rat Cxcl2 | +Inquiry |
Cxcl2-3390M | Recombinant Mouse Cxcl2 Protein | +Inquiry |
Cxcl2-010C | Active Recombinant Rat Cxcl2 Protein (73 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL2 Products
Required fields are marked with *
My Review for All CXCL2 Products
Required fields are marked with *