Recombinant Human chemokine (C-X-C motif) ligand 2, His-tagged

Cat.No. : CXCL2-224H
Product Overview : GRO-Beta Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide ch- ain containing 94 amino acids and having a molecular mass of 10.1 kDa. The GRO-b is fused to 20 amino acid His Tag at N-terminus and purified by proprietary chromatographic techniques.
Availability September 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human
Tag : His
Description : Chemokine (C-X-C motif) ligand 2 (CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. This chemokine is secreted by monocytes and macrophages and is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 mobilizes cells by interacting with a cell surface chemokine receptor called CXCR2.
Form : The Human CXCL2 protein solution contains 20mM Tris HCl.
Purity : Greater than 95.0% as determined by SDS-PAGE.
Physical Appearance : Sterile filtered colorless solution.
Amino acid sequence : MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVK VKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Storage : Lyophilized Bone Morphogenetic Protein-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
Official Symbol CXCL2
Synonyms CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a; MIP2-alpha; MIP-2a; Gro-beta; C-X-C motif chemokine 2; GRO2 oncogene; Growth-regulated protein beta; MGSA beta; chemokine (C-X-C motif) ligand 2; melanoma growth stimulatory activity beta; MIP2A_HUMAN; Macrophage inflammatory protein 2-alpha [Precursor]; Gro-beta
Gene ID 2920
mRNA Refseq NM_002089
Protein Refseq NP_002080
MIM 139110
UniProt ID P19875
Chromosome Location 4q21
Pathway Cytokine-cytokine receptor interaction
Function chemokine activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL2 Products

Required fields are marked with *

My Review for All CXCL2 Products

Required fields are marked with *

0
cart-icon