Recombinant Human CXCL2 Protein, His tagged

• Cat.No.: CXCL2-224H
• Product Overview: Recombinant Human CXCL2 Protein (35-107 aa) with His tag was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 35-107 aa
• Description: This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation.
• Form: Sterile PBS, pH7.4, 10% Glycerol
• Molecular Mass: 10 kDa
• AASequence: MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVKVKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
• Endotoxin: < 1 EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.8 mg/mL by BCA

Gene Information

• Gene Name: CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens (human) ]
• Official Symbol: CXCL2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a
• Gene ID: 2920
• mRNA Refseq: NM_002089
• Protein Refseq: NP_002080
• MIM: 139110
• UniProt ID: P19875