Recombinant Human CHGA protein(331-450 aa), C-His-tagged
| Cat.No. : | CHGA-2629H |
| Product Overview : | Recombinant Human CHGA protein(P10645)(331-450 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 331-450 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ |
| Gene Name | CHGA chromogranin A (parathyroid secretory protein 1) [ Homo sapiens ] |
| Official Symbol | CHGA |
| Synonyms | CHGA; chromogranin A (parathyroid secretory protein 1); chromogranin-A; pancreastatin; parastatin; vasostatin; SP-I; pituitary secretory protein I; parathyroid secretory protein 1; betagranin (N-terminal fragment of chromogranin A); CGA; |
| Gene ID | 1113 |
| mRNA Refseq | NM_001275 |
| Protein Refseq | NP_001266 |
| MIM | 118910 |
| UniProt ID | P10645 |
| ◆ Recombinant Proteins | ||
| CHGA-597H | Recombinant Human CHGA Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHGA-2740H | Recombinant Human CHGA protein, His-tagged | +Inquiry |
| CHGA-1229H | Recombinant Human CHGA Protein, GST-Tagged | +Inquiry |
| CHGA-1639M | Recombinant Mouse CHGA Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHGA-21HFL | Recombinant Human CHGA Protein, Full Length, C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHGA-7540HCL | Recombinant Human CHGA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHGA Products
Required fields are marked with *
My Review for All CHGA Products
Required fields are marked with *



