Recombinant Human CHGA protein(331-450 aa), C-His-tagged
Cat.No. : | CHGA-2629H |
Product Overview : | Recombinant Human CHGA protein(P10645)(331-450 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 331-450 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ |
Gene Name | CHGA chromogranin A (parathyroid secretory protein 1) [ Homo sapiens ] |
Official Symbol | CHGA |
Synonyms | CHGA; chromogranin A (parathyroid secretory protein 1); chromogranin-A; pancreastatin; parastatin; vasostatin; SP-I; pituitary secretory protein I; parathyroid secretory protein 1; betagranin (N-terminal fragment of chromogranin A); CGA; |
Gene ID | 1113 |
mRNA Refseq | NM_001275 |
Protein Refseq | NP_001266 |
MIM | 118910 |
UniProt ID | P10645 |
◆ Recombinant Proteins | ||
CHGA-26904TH | Recombinant Human CHGA, His-tagged | +Inquiry |
CHGA-3193HF | Recombinant Full Length Human CHGA Protein, GST-tagged | +Inquiry |
CHGA-1712H | Recombinant Human CHGA Protein (Leu19-Gly457), N-His tagged | +Inquiry |
CHGA-3390M | Recombinant Mouse CHGA Protein | +Inquiry |
CHGA-403H | Recombinant Human Chromogranin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHGA-7540HCL | Recombinant Human CHGA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHGA Products
Required fields are marked with *
My Review for All CHGA Products
Required fields are marked with *