Recombinant Human CHGA protein(331-450 aa), C-His-tagged

• Cat.No.: CHGA-2629H
• Product Overview: Recombinant Human CHGA protein(P10645)(331-450 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 331-450 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ

Gene Information

• Gene Name: CHGA chromogranin A (parathyroid secretory protein 1) [ Homo sapiens ]
• Official Symbol: CHGA
• Synonyms: CHGA; chromogranin A (parathyroid secretory protein 1); chromogranin-A; pancreastatin; parastatin; vasostatin; SP-I; pituitary secretory protein I; parathyroid secretory protein 1; betagranin (N-terminal fragment of chromogranin A); CGA
• Gene ID: 1113
• mRNA Refseq: NM_001275
• Protein Refseq: NP_001266
• MIM: 118910
• UniProt ID: P10645