Recombinant Human CHI3L1 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CHI3L1-044H |
Product Overview : | CHI3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001267) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Protein Length : | 1-383 aa |
Description : | Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling. |
Molecular Mass : | 42.6 kDa |
AA Sequence : | MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISGPGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CHI3L1 chitinase 3 like 1 [ Homo sapiens (human) ] |
Official Symbol | CHI3L1 |
Synonyms | CHI3L1; chitinase 3 like 1; ASRT7; CGP-39; GP-39; GP39; HC-gp39; HCGP-3P; hCGP-39; YK-40; YKL-40; YKL40; YYL-40; chitinase-3-like protein 1; 39 kDa synovial protein; cartilage glycoprotein 39; chitinase 3-like 1 (cartilage glycoprotein-39) |
Gene ID | 1116 |
mRNA Refseq | NM_001276 |
Protein Refseq | NP_001267 |
MIM | 601525 |
UniProt ID | P36222 |
◆ Recombinant Proteins | ||
Chi3l1-5874R | Recombinant Rat Chi3l1 protein, His-tagged | +Inquiry |
CHI3L1-1370R | Recombinant Rat CHI3L1 Protein | +Inquiry |
CHI3L1-774H | Recombinant Human CHI3L1 Protein, His-tagged | +Inquiry |
CHI3L1-044H | Recombinant Human CHI3L1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Chi3l1-1238R | Recombinant Rat Chi3l1 protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
CHI3L1-03HFL | Recombinant Full Length Human CHI3L1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHI3L1-2521HCL | Recombinant Human CHI3L1 cell lysate | +Inquiry |
CHI3L1-1715MCL | Recombinant Mouse CHI3L1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHI3L1 Products
Required fields are marked with *
My Review for All CHI3L1 Products
Required fields are marked with *