Recombinant Human CHI3L1 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : CHI3L1-044H
Product Overview : CHI3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001267) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Protein Length : 1-383 aa
Description : Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling.
Molecular Mass : 42.6 kDa
AA Sequence : MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISGPGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAATTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CHI3L1 chitinase 3 like 1 [ Homo sapiens (human) ]
Official Symbol CHI3L1
Synonyms CHI3L1; chitinase 3 like 1; ASRT7; CGP-39; GP-39; GP39; HC-gp39; HCGP-3P; hCGP-39; YK-40; YKL-40; YKL40; YYL-40; chitinase-3-like protein 1; 39 kDa synovial protein; cartilage glycoprotein 39; chitinase 3-like 1 (cartilage glycoprotein-39)
Gene ID 1116
mRNA Refseq NM_001276
Protein Refseq NP_001267
MIM 601525
UniProt ID P36222

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHI3L1 Products

Required fields are marked with *

My Review for All CHI3L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon