Recombinant Human CHL1 Protein, GST-Tagged
| Cat.No. : | CHL1-1244H |
| Product Overview : | Human CHL1 partial ORF (NP_006605, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the L1 gene family of neural cell adhesion molecules. It is a neural recognition molecule that may be involved in signal transduction pathways. The deletion of one copy of this gene may be responsible for mental defects in patients with 3p- syndrome. This protein may also play a role in the growth of certain cancers. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Nov 2011] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHL1 cell adhesion molecule with homology to L1CAM (close homolog of L1) [ Homo sapiens ] |
| Official Symbol | CHL1 |
| Synonyms | CHL1; cell adhesion molecule with homology to L1CAM (close homolog of L1); cell adhesion molecule with homology to L1CAM (close homologue of L1); neural cell adhesion molecule L1-like protein; CALL; cell adhesion molecule L1 like; FLJ44930; L1CAM2; MGC132578; neural cell adhesion molecule; close homolog of L1; L1 cell adhesion molecule 2; FLJ30674; DKFZp547L174; |
| Gene ID | 10752 |
| mRNA Refseq | NM_001253387 |
| Protein Refseq | NP_001240316 |
| MIM | 607416 |
| UniProt ID | O00533 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHL1 Products
Required fields are marked with *
My Review for All CHL1 Products
Required fields are marked with *



