Recombinant Human CHL1 Protein, GST-Tagged

Cat.No. : CHL1-1244H
Product Overview : Human CHL1 partial ORF (NP_006605, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the L1 gene family of neural cell adhesion molecules. It is a neural recognition molecule that may be involved in signal transduction pathways. The deletion of one copy of this gene may be responsible for mental defects in patients with 3p- syndrome. This protein may also play a role in the growth of certain cancers. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Nov 2011]
Molecular Mass : 37.84 kDa
AA Sequence : EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHL1 cell adhesion molecule with homology to L1CAM (close homolog of L1) [ Homo sapiens ]
Official Symbol CHL1
Synonyms CHL1; cell adhesion molecule with homology to L1CAM (close homolog of L1); cell adhesion molecule with homology to L1CAM (close homologue of L1); neural cell adhesion molecule L1-like protein; CALL; cell adhesion molecule L1 like; FLJ44930; L1CAM2; MGC132578; neural cell adhesion molecule; close homolog of L1; L1 cell adhesion molecule 2; FLJ30674; DKFZp547L174;
Gene ID 10752
mRNA Refseq NM_001253387
Protein Refseq NP_001240316
MIM 607416
UniProt ID O00533

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHL1 Products

Required fields are marked with *

My Review for All CHL1 Products

Required fields are marked with *

0
cart-icon