Recombinant Human CHMP2A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CHMP2A-4011H |
| Product Overview : | CHMP2A MS Standard C13 and N15-labeled recombinant protein (NP_940818) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression. |
| Molecular Mass : | 25.1 kDa |
| AA Sequence : | MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CHMP2A charged multivesicular body protein 2A [ Homo sapiens (human) ] |
| Official Symbol | CHMP2A |
| Synonyms | CHMP2A; charged multivesicular body protein 2A; chromatin modifying protein 2A; charged multivesicular body protein 2a; BC 2; CHMP2; putative breast adenocarcinoma marker (32kD); VPS2; VPS2 homolog A (S. cerevisiae); VPS2A; vps2-1; hVps2-1; VPS2 homolog A; chromatin-modifying protein 2a; putative breast adenocarcinoma marker BC-2; vacuolar protein sorting-associated protein 2-1; BC2; BC-2; |
| Gene ID | 27243 |
| mRNA Refseq | NM_198426 |
| Protein Refseq | NP_940818 |
| MIM | 610893 |
| UniProt ID | O43633 |
| ◆ Recombinant Proteins | ||
| CHMP2A-27958TH | Recombinant Human CHMP2A, His-tagged | +Inquiry |
| CHMP2A-1249H | Recombinant Human CHMP2A Protein, GST-Tagged | +Inquiry |
| CHMP2A-1650M | Recombinant Mouse CHMP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHMP2A-3405M | Recombinant Mouse CHMP2A Protein | +Inquiry |
| CHMP2A-849R | Recombinant Rhesus monkey CHMP2A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHMP2A-7532HCL | Recombinant Human CHMP2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP2A Products
Required fields are marked with *
My Review for All CHMP2A Products
Required fields are marked with *
