Recombinant Human CHMP2A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CHMP2A-4011H
Product Overview : CHMP2A MS Standard C13 and N15-labeled recombinant protein (NP_940818) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.
Molecular Mass : 25.1 kDa
AA Sequence : MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CHMP2A charged multivesicular body protein 2A [ Homo sapiens (human) ]
Official Symbol CHMP2A
Synonyms CHMP2A; charged multivesicular body protein 2A; chromatin modifying protein 2A; charged multivesicular body protein 2a; BC 2; CHMP2; putative breast adenocarcinoma marker (32kD); VPS2; VPS2 homolog A (S. cerevisiae); VPS2A; vps2-1; hVps2-1; VPS2 homolog A; chromatin-modifying protein 2a; putative breast adenocarcinoma marker BC-2; vacuolar protein sorting-associated protein 2-1; BC2; BC-2;
Gene ID 27243
mRNA Refseq NM_198426
Protein Refseq NP_940818
MIM 610893
UniProt ID O43633

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHMP2A Products

Required fields are marked with *

My Review for All CHMP2A Products

Required fields are marked with *

0
cart-icon
0
compare icon