Recombinant Human CHMP3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CHMP3-6095H |
| Product Overview : | VPS24 MS Standard C13 and N15-labeled recombinant protein (NP_057163) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene. |
| Molecular Mass : | 25.1 kDa |
| AA Sequence : | MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CHMP3 charged multivesicular body protein 3 [ Homo sapiens (human) ] |
| Official Symbol | CHMP3 |
| Synonyms | CHMP3; charged multivesicular body protein 3; NEDF; VPS24; CGI-149; charged multivesicular body protein 3; 25.1 protein; CHMP family, member 3; chromatin-modifying protein 3; neuroendocrine differentiation factor; vacuolar protein sorting 24 homolog; vacuolar protein sorting-associated protein 24 |
| Gene ID | 51652 |
| mRNA Refseq | NM_016079 |
| Protein Refseq | NP_057163 |
| MIM | 610052 |
| UniProt ID | Q9Y3E7 |
| ◆ Recombinant Proteins | ||
| CHMP3-1376R | Recombinant Rat CHMP3 Protein | +Inquiry |
| CHMP3-1652M | Recombinant Mouse CHMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHMP3-3234H | Recombinant Human CHMP3 Protein, MYC/DDK-tagged | +Inquiry |
| CHMP3-1034R | Recombinant Rat CHMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHMP3-12507Z | Recombinant Zebrafish CHMP3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP3 Products
Required fields are marked with *
My Review for All CHMP3 Products
Required fields are marked with *
