Recombinant Human CHMP5, His-tagged
| Cat.No. : | CHMP5-27751TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-219 of Human CHMP5, with N terminal His tag; 219 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-219 a.a. |
| Description : | CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitution with 151 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDA ELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQ RDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEM KKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYG TPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPE GVPTDTKNKDGVLVDEFGLPQIPAS |
| Full Length : | Full L. |
| Gene Name | CHMP5 charged multivesicular body protein 5 [ Homo sapiens ] |
| Official Symbol | CHMP5 |
| Synonyms | CHMP5; charged multivesicular body protein 5; C9orf83, chromatin modifying protein 5 , chromosome 9 open reading frame 83 , SNF7DC2; CGI 34; HSPC177; Vps60; |
| Gene ID | 51510 |
| mRNA Refseq | NM_001195536 |
| Protein Refseq | NP_001182465 |
| MIM | 610900 |
| Uniprot ID | Q9NZZ3 |
| Chromosome Location | 9p13.3 |
| Pathway | ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| CHMP5-3208HF | Recombinant Full Length Human CHMP5 Protein, GST-tagged | +Inquiry |
| CHMP5-678R | Recombinant Rhesus Macaque CHMP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHMP5-7172H | Recombinant Human Charged Multivesicular Body Protein 5, His-tagged | +Inquiry |
| CHMP5-1377R | Recombinant Rat CHMP5 Protein | +Inquiry |
| CHMP5-1253H | Recombinant Human CHMP5 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHMP5-7530HCL | Recombinant Human CHMP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP5 Products
Required fields are marked with *
My Review for All CHMP5 Products
Required fields are marked with *
