Recombinant Human CHN1 protein, His-tagged

• Cat.No.: CHN1-3093H
• Product Overview: Recombinant Human CHN1 protein(145-207 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 145-207 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: HVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHN
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CHN1 chimerin (chimaerin) 1 [ Homo sapiens ]
• Official Symbol: CHN1
• Synonyms: CHN1; chimerin (chimaerin) 1; CHN, Duane retraction syndrome 2 , DURS2; N-chimaerin; ARHGAP2; Chimerin 1 (GTPase activating protein; rho; 2); n chimerin; RhoGAP2; n-chimerin; A-chimaerin; a2-chimaerin; alpha-chimerin; Rho GTPase-activating protein 2; NC; CHN; DURS2; RHOGAP2
• Gene ID: 1123
• mRNA Refseq: NM_001025201
• Protein Refseq: NP_001020372
• MIM: 118423
• UniProt ID: P15882