Recombinant Human CHN1 protein, His-tagged
Cat.No. : | CHN1-3093H |
Product Overview : | Recombinant Human CHN1 protein(145-207 aa), fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 145-207 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CHN1 chimerin (chimaerin) 1 [ Homo sapiens ] |
Official Symbol | CHN1 |
Synonyms | CHN1; chimerin (chimaerin) 1; CHN, Duane retraction syndrome 2 , DURS2; N-chimaerin; ARHGAP2; Chimerin 1 (GTPase activating protein; rho; 2); n chimerin; RhoGAP2; n-chimerin; A-chimaerin; a2-chimaerin; alpha-chimerin; Rho GTPase-activating protein 2; NC; CHN; DURS2; RHOGAP2; |
Gene ID | 1123 |
mRNA Refseq | NM_001025201 |
Protein Refseq | NP_001020372 |
MIM | 118423 |
UniProt ID | P15882 |
◆ Recombinant Proteins | ||
CHN1-3211HF | Recombinant Full Length Human CHN1 Protein, GST-tagged | +Inquiry |
CHN1-3093H | Recombinant Human CHN1 protein, His-tagged | +Inquiry |
CHN1-3758H | Recombinant Human CHN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CHN1-7844H | Recombinant Human CHN1 protein, GST-tagged | +Inquiry |
CHN1-7843H | Recombinant Human CHN1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHN1-001HCL | Recombinant Human CHN1 cell lysate | +Inquiry |
CHN1-002HCL | Recombinant Human CHN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHN1 Products
Required fields are marked with *
My Review for All CHN1 Products
Required fields are marked with *