Recombinant Human CHN1 protein, His-tagged

Cat.No. : CHN1-3093H
Product Overview : Recombinant Human CHN1 protein(145-207 aa), fused to His tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 145-207 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : HVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHN
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CHN1 chimerin (chimaerin) 1 [ Homo sapiens ]
Official Symbol CHN1
Synonyms CHN1; chimerin (chimaerin) 1; CHN, Duane retraction syndrome 2 , DURS2; N-chimaerin; ARHGAP2; Chimerin 1 (GTPase activating protein; rho; 2); n chimerin; RhoGAP2; n-chimerin; A-chimaerin; a2-chimaerin; alpha-chimerin; Rho GTPase-activating protein 2; NC; CHN; DURS2; RHOGAP2;
Gene ID 1123
mRNA Refseq NM_001025201
Protein Refseq NP_001020372
MIM 118423
UniProt ID P15882

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHN1 Products

Required fields are marked with *

My Review for All CHN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon